Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate CCNA_03235 CCNA_03235 spermidine/putrescine transport ATP-binding protein potA
Query= CharProtDB::CH_003736 (237 letters) >FitnessBrowser__Caulo:CCNA_03235 Length = 381 Score = 112 bits (279), Expect = 1e-29 Identities = 75/214 (35%), Positives = 121/214 (56%), Gaps = 7/214 (3%) Query: 3 KVMLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRI 62 K +++F+ V+ +GK+ A+ VSL +N+GE L+G +G GKTTLL L G T GRI Sbjct: 12 KPIITFENVTKRFGKLAAVDNVSLTVNEGEFFALLGPSGCGKTTLLRMLAGFETPTEGRI 71 Query: 63 VFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFF--AERDQFQERIKWV 120 + D +DI++ K V +V + VF MTV +N+A G + + + R+ Sbjct: 72 LIDGQDISNVPPNK---RPVNMVFQSYAVFPHMTVADNVAYGLKVDNVPKAEREARVAEA 128 Query: 121 YELFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTI 180 EL +L ++ +SGG++Q +A+ RAL+ PR+LLLDEP L + +Q+ + Sbjct: 129 LELV-QLGGLGGRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLREQMRTEL 187 Query: 181 EQLREQ-GMTIFLVEQNANQALKLADRGYVLENG 213 L+E+ G+T +V + ++AL LA R V+ G Sbjct: 188 CTLQEKVGITFIMVTHDQDEALALASRCAVMSKG 221 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 381 Length adjustment: 27 Effective length of query: 210 Effective length of database: 354 Effective search space: 74340 Effective search space used: 74340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory