Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate CCNA_00006 CCNA_00006 enoyl-CoA hydratase
Query= reanno::psRCH2:GFF2389 (257 letters) >FitnessBrowser__Caulo:CCNA_00006 Length = 262 Score = 315 bits (807), Expect = 6e-91 Identities = 168/256 (65%), Positives = 197/256 (76%), Gaps = 4/256 (1%) Query: 3 FETLLVDIQER---VALITLNRPQALNALNGQLISELNQALGQLEADPQIGCIVLTGSAK 59 F+TL+V+ E V LI LNRP+ALNALN L+ EL QAL +AD +GCIVLTGSAK Sbjct: 4 FQTLIVEAPESAPGVTLIRLNRPEALNALNTALLGELAQALAAAQADDSVGCIVLTGSAK 63 Query: 60 AFAAGADIKEMAELTYPQIYLDDFF-ADADRIATRRKPLIAAVAGYALGGGCELALLCDM 118 AFAAGADIKEM++ TY Q++ DFF A A I RKP+IAAVAGYALGGGCELA++CD Sbjct: 64 AFAAGADIKEMSDKTYAQMFKADFFTAGARAIEQCRKPIIAAVAGYALGGGCELAMMCDF 123 Query: 119 IFAADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAERAGLVAR 178 I AAD A+FGQPE+NLGV PGIGGTQRLTR VGK+KAMDM LTGR M A EAER+GLV+R Sbjct: 124 ILAADTAKFGQPEINLGVAPGIGGTQRLTRFVGKSKAMDMILTGRMMGAEEAERSGLVSR 183 Query: 179 VFPAESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHAVFATAD 238 +FPA+SL++ETL A IA +S A M KE V A+ETTL G+ ERR+FH++FA D Sbjct: 184 IFPADSLVDETLAIAAKIAGQSPLAVAMNKELVEAAYETTLTTGVALERRLFHSLFAFED 243 Query: 239 QKEGMAAFSEKRKPEF 254 QKEGM AF EKRKP F Sbjct: 244 QKEGMTAFVEKRKPLF 259 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 262 Length adjustment: 24 Effective length of query: 233 Effective length of database: 238 Effective search space: 55454 Effective search space used: 55454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory