Align TRAP-type large permease component (characterized, see rationale)
to candidate 208936 DVU0009 DedA family protein (TIGR)
Query= uniprot:Q930R2 (425 letters) >FitnessBrowser__DvH:208936 Length = 426 Score = 298 bits (764), Expect = 2e-85 Identities = 165/414 (39%), Positives = 244/414 (58%), Gaps = 1/414 (0%) Query: 1 MTLVVFIVSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTQIIAQNMIAGADTFTLLAIP 60 MT +V L A P+ ++ + G + + Q + AGAD+F LLA+P Sbjct: 1 MTALVLFGMLGLLFACNAPIMLAVGASAFAALLIKGGMDPMVAVQRLYAGADSFPLLAVP 60 Query: 61 FFILAGELMNAGGLSRRIIDFAIACVGHIRGGLGIVAIMAAVIMASISGSAAADTAALAA 120 F+ AG+LM+AGG+S+RI+ A VGH+ GGL +V++++++ A +SGSAAADTAA+ + Sbjct: 61 LFMTAGQLMSAGGISQRIVRLADTLVGHLPGGLAVVSVVSSMFFAGVSGSAAADTAAVGS 120 Query: 121 ILIPMMAKAGYNVPRSAGLIAAGGVIAPVIPPSMAFIVFGVAANVSITQLFMAGIVPGLI 180 ILIP M GY+ + + AA G I VIPPS+ IVFG SI +LF G++PGL+ Sbjct: 121 ILIPSMVARGYSPAFAGAVQAAAGSIGVVIPPSIPMIVFGALTGASIGKLFAGGVMPGLL 180 Query: 181 MGIALVATWLLVVRKDDIQPLPRTPMKERVGATGRALWALGMPVIILGGIKAGVVTPTEA 240 MGI L A W + + R A RA W+LG P IILGGI +GV T TEA Sbjct: 181 MGITLSA-WCVHEGLRSGRETRRFEPAAVWPALLRAGWSLGAPAIILGGIISGVCTATEA 239 Query: 241 AVVAAVYALFVGMVIYRELKPRDLPGVILQAAKTTAVIMFLVCAALVSSWLITAANIPSE 300 A VA VYA VG+ +REL R LP ++L AA T+ V+M ++ AA + W++ IP+ Sbjct: 240 AAVAVVYAFLVGLFAHRELDLRRLPALLLDAAVTSGVVMSIIAAASLFGWVMAIERIPAA 299 Query: 301 ITGFISPLIDRPTLLMFVIMLVVLVVGTALDLTPTILILTPVLMPIIKQAGIDPVYFGVL 360 + I + +L+ + +++L+ GT L+ T +++L PVL+ ++ + GID ++ GV+ Sbjct: 300 LADAILAVGGEGWMLLLAVNILLLLAGTMLETTAALILLVPVLVQLLPRMGIDLIHLGVI 359 Query: 361 FIMNTCIGLLTPPVGVVLNVVSGVGRVPLGKVIVGVTPFLVAQILVLFLLVLFP 414 +MN IG+LTPP+GV L V G+ RVPL + V P L ++ L L+ P Sbjct: 360 VVMNLSIGMLTPPLGVCLMVSCGIARVPLATLARAVLPLLAVLVVDLMLVTYIP 413 Lambda K H 0.331 0.145 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 426 Length adjustment: 32 Effective length of query: 393 Effective length of database: 394 Effective search space: 154842 Effective search space used: 154842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory