Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate 209027 DVU0098 polyamine ABC transporter, ATP-binding protein (TIGR)
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__DvH:209027 Length = 368 Score = 202 bits (514), Expect = 1e-56 Identities = 111/273 (40%), Positives = 170/273 (62%), Gaps = 12/273 (4%) Query: 22 AVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEAVSSPRRVMMSP 81 A+DN+ + I +G +LGPSG GKTT LRLI+G E+P +G I + + P Sbjct: 22 ALDNIDLEIRNGEFLTLLGPSGCGKTTILRLISGFEKPDAGVITLKGQRMDDA-----PP 76 Query: 82 EKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIENKVKEVSEELGLSGVLNRYPK 141 E R + VFQN+AL+P+M+V +N+ F L++ + PKD+I +V + + L +R P+ Sbjct: 77 EARQVNTVFQNYALFPHMSVRENVGFGLRMQRRPKDEIARRVHDALRMVHLEAHADRRPR 136 Query: 142 ELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTLIVSH 201 +LSGGQ QR AIARA+V +P VLLLDEPFS LD ++R+ + ++ +QR+ +T + V+H Sbjct: 137 QLSGGQQQRVAIARAVVNNPLVLLLDEPFSALDYKLRKQMQLEIKHLQRQLGITFVFVTH 196 Query: 202 DPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTGEINLIQAKIIEN----- 256 D + FA++++ V+ +GK QIG+P EIYE PA +AR GEIN++ A I N Sbjct: 197 DQEEAFAMSDRVVVMNDGKIEQIGSPQEIYEEPANLYVARFVGEINILNAVIAANHGDGL 256 Query: 257 -NAIIANLKVPLNNMELKGQSNIV-IGLRPDDL 287 +A+I + P+ + + V + LRP+DL Sbjct: 257 YDAVIEGVTFPIRSQRTFAPGDKVNVLLRPEDL 289 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 368 Length adjustment: 30 Effective length of query: 341 Effective length of database: 338 Effective search space: 115258 Effective search space used: 115258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory