Align Inner-membrane translocator (characterized, see rationale)
to candidate N515DRAFT_2415 N515DRAFT_2415 simple sugar transport system permease protein
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__Dyella79:N515DRAFT_2415 Length = 337 Score = 124 bits (311), Expect = 4e-33 Identities = 103/339 (30%), Positives = 166/339 (48%), Gaps = 20/339 (5%) Query: 48 NARYQAGKSTSMGRYLW-------PLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDI 100 NA A S + GR W PLL +L +A ++ LID Sbjct: 2 NAVAPAATSAAAGRRPWWRRRAQVPLLVTLVLFVAMAGAGGVLYHGFLTPQVFLNLLID- 60 Query: 101 LNRSAPVALLSIGMSLVIATGGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVG 160 +A + ++++GM+ VI GGIDLSVGAV+A + + A L+ + IA L VG Sbjct: 61 ---NAFLCIVAVGMTFVILAGGIDLSVGAVVAFSTVLLAELVQRHGWPPLAAIALVLAVG 117 Query: 161 LLAGCINGGLVSFLGIQPIVATLLLMVAGRGVAQLINQGQIITFQHPGFAAIG-----VG 215 G G L+ +QP V TL M RGVA LI+ I P A++ +G Sbjct: 118 TGFGAGMGVLIQRFRLQPFVVTLAGMFLARGVATLISVDS-IDIDQPWLASVANLRLPLG 176 Query: 216 QFLGLPMPVWIVIGMLTFSQLLLRKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIA 275 L + + + ++ LL ++ G + A+G + ++R +G+ + + Y ++ Sbjct: 177 GGSMLSVGALVALAVVAAGALLAGASSFGRTVYAIGGSESSARLMGLPVDATVVRVYALS 236 Query: 276 GLCAALAGMISTADIQGSDANNAGLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQ 335 G CAALAG++ T + + +A L LELDA+ AVVIGG L GG ++ +++G L++ Sbjct: 237 GFCAALAGVVYTLYMLSGYSQHA-LGLELDAIAAVVIGGTVLAGGSGYVLGTLLGVLVLG 295 Query: 336 TLATTIIVSG-LPAKFNLLIKAIVILTVLLLQSAKFRRQ 373 + T I+ G L + + ++ ++L LLQ FRR+ Sbjct: 296 LIQTLIVFDGELSSWWTRIVIGALLLAFCLLQRL-FRRK 333 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 337 Length adjustment: 30 Effective length of query: 375 Effective length of database: 307 Effective search space: 115125 Effective search space used: 115125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory