Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate N515DRAFT_1562 N515DRAFT_1562 sulfate transport system ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__Dyella79:N515DRAFT_1562 Length = 384 Score = 177 bits (448), Expect = 6e-49 Identities = 109/308 (35%), Positives = 175/308 (56%), Gaps = 23/308 (7%) Query: 22 AVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTSGYIYFDNEAVSSPRRVMMSP 81 A+D+ S+ I G +LGPSG GK++ LR++AGL++P G + D + + + Sbjct: 17 ALDDFSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVLRDGTDL-----LALPA 71 Query: 82 EKRGIAMVFQNWALYPNMTVFDNIAFPLKL---AKVPKDK-IENKVKEVSEELGLSGVLN 137 ++R I +VFQ++AL+P+MTV DNIAF L++ A+ P + I +V+++ + L + Sbjct: 72 QRRDIGLVFQHYALFPHMTVADNIAFGLRVRPRARRPSRRDIAARVEDLLRRVQLEELGR 131 Query: 138 RYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRESARALVRKIQRERKLTTL 197 RYP +LSGGQ QR A+ARAL +P +LLLDEPF LDAQ+R + R +R +QR LTT+ Sbjct: 132 RYPTQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLRVWLRDLQRSLGLTTV 191 Query: 198 IVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIARLTGEINLIQAKIIENN 257 +V+HD + +A++ V+ G+ Q+G P+EIY PAT + G N I+ + + Sbjct: 192 LVTHDQDEALELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGFVGRANRIRGHVERDR 251 Query: 258 AIIANLKVPLNNMELKGQ---SNIVIGLRPDDLTLSDTLLD------KYIDMG--IVKVK 306 + EL G I LRP+ L L+ L +++D+ + + + Sbjct: 252 LHLGGHSF---QGELPGDLAGREIEAWLRPEHLALASRGLGGWTGRLQHLDLAGPVARAR 308 Query: 307 LVSYGAGI 314 L +G G+ Sbjct: 309 LAMHGDGL 316 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 384 Length adjustment: 30 Effective length of query: 341 Effective length of database: 354 Effective search space: 120714 Effective search space used: 120714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory