Align Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate N515DRAFT_1248 N515DRAFT_1248 ABC-2 type transport system ATP-binding protein
Query= TCDB::B8H229 (515 letters) >FitnessBrowser__Dyella79:N515DRAFT_1248 Length = 315 Score = 89.0 bits (219), Expect = 2e-22 Identities = 70/221 (31%), Positives = 111/221 (50%), Gaps = 9/221 (4%) Query: 4 LDVSQVSKSFPG-VRALDQVDLVVGVGEVHALLGENGAGKSTLIKILSAAHAADAGTVTF 62 + V +SK++ G +AL +DL + GE+ ALLG NGAGK+TLI I+ AGTV+ Sbjct: 12 VSVRGISKTYKGGFQALKSIDLDIRRGEIFALLGPNGAGKTTLISIICGIVKPSAGTVSA 71 Query: 63 AGQVLDPRDAPLRRQQLGIATIYQEFNLFPELSVAENMYLGREPRRLGLVDWSRLRADAQ 122 G + RD L R ++G+ + QE + +V + R GL +R + Sbjct: 72 DGHDV-LRDYRLTRAKIGL--VPQELSTDAFETVWAAVRFSR-----GLFGRARDDRHIE 123 Query: 123 ALLNDLGLPLNPDAPVRGLTVAEQQMVEIAKAMTLNARLIIMDEPTAALSGREVDRLHAI 182 +L DL L DA + L+ ++ V IAKA+ ++ +DEPTA + + + Sbjct: 124 KVLRDLSLWEKKDAKIMTLSGGMKRRVLIAKALAHEPSILFLDEPTAGVDVELRHDMWEM 183 Query: 183 IAGLKARSVSVIYVSHRLGEVKAMCDRYTVMRDGRFVASGD 223 + L+A V+VI +H + E + M DR V+ G + D Sbjct: 184 VRRLRATGVTVILTTHYIEEAEEMADRVGVITRGELILVED 224 Score = 74.3 bits (181), Expect = 6e-18 Identities = 61/212 (28%), Positives = 104/212 (49%), Gaps = 24/212 (11%) Query: 275 LRQVSFAARGGEIVGLAGLVGAGRTDLARLIFGADPIAAGRVLVDDKPLRLRSPRDAIQA 334 L+ + R GEI L G GAG+T L +I G +AG V D + LR R +A Sbjct: 28 LKSIDLDIRRGEIFALLGPNGAGKTTLISIICGIVKPSAGTVSADGHDV-LRDYR-LTRA 85 Query: 335 GIMLVPEDRKQQGCFLDHSIRRNLSLPSLKALSAL-----GQWVDERAERDLVETYRQKL 389 I LVP++ LS + + + A G + R +R + + R Sbjct: 86 KIGLVPQE---------------LSTDAFETVWAAVRFSRGLFGRARDDRHIEKVLRDLS 130 Query: 390 RIKMADAETAIGKLSGGNQQKVLLGRAMALTPKVLIVDEPTRGIDIGAKAEVHQVLSDLA 449 + DA+ I LSGG +++VL+ +A+A P +L +DEPT G+D+ + ++ +++ L Sbjct: 131 LWEKKDAK--IMTLSGGMKRRVLIAKALAHEPSILFLDEPTAGVDVELRHDMWEMVRRLR 188 Query: 450 DLGVAVVVISSELAEVMAVSDRIVVFREGVIV 481 GV V++ + + E ++DR+ V G ++ Sbjct: 189 ATGVTVILTTHYIEEAEEMADRVGVITRGELI 220 Lambda K H 0.320 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 515 Length of database: 315 Length adjustment: 31 Effective length of query: 484 Effective length of database: 284 Effective search space: 137456 Effective search space used: 137456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory