Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate N515DRAFT_2414 N515DRAFT_2414 simple sugar transport system permease protein
Query= TCDB::Q7BSH3 (333 letters) >FitnessBrowser__Dyella79:N515DRAFT_2414 Length = 358 Score = 119 bits (297), Expect = 1e-31 Identities = 95/295 (32%), Positives = 139/295 (47%), Gaps = 8/295 (2%) Query: 34 GNLAGIFNDTSILIILALAQMTVILTKSIDLSVAANLAFTGMAIAMMNAAHPD----LPL 89 GNL I + + L +++L VI + +D+SV A LA +A H LPL Sbjct: 63 GNLIDIAHRAAPLALVSLGMTLVIALRGLDISVGAVLAIAA-TVAAWTIGHVSNDGLLPL 121 Query: 90 VVLILMAVVIGACLGAINGFLVWALEIPPIVVTLGTLTIYRGMAFVLSGGAWVNAHQMTP 149 + I A+ GA G NG+LV + PIV TL + RG+A +SGG + + Sbjct: 122 WLAIAAALAAGALCGLWNGWLVVGAGMQPIVATLILMVAGRGIAQSISGGQILTLYYAPY 181 Query: 150 IFLSVPRTPVLGLPVLSWVGIIIVILMYVLLRYTQFGRSAYATGGNPTAAVYAGIDTGWT 209 FL VLGLP +V + L+ + LR T G A G NP AA AG+ Sbjct: 182 SFLG--NGFVLGLPFSLFVVAAVFALLQLALRKTALGLFVRAIGHNPQAAHVAGVRARAI 239 Query: 210 KFLAFVLSGALAGLASYLWVSRYAVAYVDIAN-GFELDSVAACVIGGISIAGGVGSVAGT 268 A+V G A LA L S A + A ELD++ A +GG + GG S+AG+ Sbjct: 240 TLGAYVFCGIAAALAGLLVSSNVNSADANNAGLLLELDAILAVALGGSLLGGGRFSLAGS 299 Query: 269 VLGALFLGVIKNALPVIGISPFTQMAISGTVIILAVAFNARRERNRGRIILRDRA 323 +LGAL + + + IG+ P +A+ ++ + + R + R +LR RA Sbjct: 300 LLGALIIQALTTTIYAIGVPPQVNLAVKAVLVFAVMLLQSPLCRGQLRALLRLRA 354 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 358 Length adjustment: 29 Effective length of query: 304 Effective length of database: 329 Effective search space: 100016 Effective search space used: 100016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory