Align Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; FBPA; EC 4.1.2.13 (characterized)
to candidate N515DRAFT_0914 N515DRAFT_0914 fructose-bisphosphate aldolase, class I
Query= SwissProt::P58315 (263 letters) >FitnessBrowser__Dyella79:N515DRAFT_0914 Length = 305 Score = 175 bits (443), Expect = 1e-48 Identities = 100/247 (40%), Positives = 140/247 (56%), Gaps = 23/247 (9%) Query: 14 RRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKY---YD 70 R G ++L D G+EHGP DF NP + DP+Y RLA + F + G+AEKY Y Sbjct: 38 RNGSLLVLPLDQGLEHGPTDFFPNPPAVDPDYQFRLAVEGNFSAIALGVGLAEKYMGEYC 97 Query: 71 GSVPLILKLNGKTTL-YNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELAR 129 G +PLILKLNGKT + + E S SVE+AV LGA AVGYT+Y GS + + + R Sbjct: 98 GRIPLILKLNGKTNIPSDAEATSPLFASVEDAVRLGADAVGYTMYVGSPRQAEEIRQFER 157 Query: 130 IKRDAVKFDLPLVVWSYPRGGKVVNETAPEIV---AYAARIALELGADAMKIKYTGDPKT 186 +++D ++ +PLV+WSYPRG V + + YAAR+ALE+GAD +K+ D + Sbjct: 158 VRQDCERYGMPLVMWSYPRGEAVEAKGGKNSLFAQDYAARVALEMGADIVKLHEPNDHRA 217 Query: 187 FSWA----------------VKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAV 230 + A V+ AG+ VL SGG K + L++VE + +GA G+ Sbjct: 218 NAPAPYDQLQEDAAARSARVVRSAGRTMVLFSGGEKNDDDAAVLRKVEFYMASGAQGVMF 277 Query: 231 GRNVWQR 237 GRN+W R Sbjct: 278 GRNMWLR 284 Lambda K H 0.318 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 305 Length adjustment: 26 Effective length of query: 237 Effective length of database: 279 Effective search space: 66123 Effective search space used: 66123 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory