Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate HSERO_RS23440 HSERO_RS23440 isovaleryl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__HerbieS:HSERO_RS23440 Length = 394 Score = 228 bits (582), Expect = 2e-64 Identities = 138/375 (36%), Positives = 212/375 (56%), Gaps = 8/375 (2%) Query: 20 DDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPGLDY 79 +D +R+A A+A ++APR E R + +++++G++G+LG T+ E+YGG GL Y Sbjct: 13 EDIAALREAVAAFAHSEIAPRAAEIDRSDQFPMDLWKKLGDLGVLGITVSEEYGGAGLGY 72 Query: 80 VSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCFGLT 139 +++ + E+ R + S+L + I G++ QK KYLP+L +G++IG ++ Sbjct: 73 LAHIIAMEEISRASASVGLSYGAHSNLCVNQIKRNGNEEQKRKYLPRLISGDFIGALAMS 132 Query: 140 EPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRDEIRGFIL 198 EPN GSD SM RA K Y L+GSKMWITN P ADV VV+AK D E G + F++ Sbjct: 133 EPNAGSDVVSMKLRADKKGDRYVLNGSKMWITNGPDADVLVVYAKTDLEAGARGMTAFLV 192 Query: 199 EKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENILPHV-KGLRGPFTCLNSARYGI 257 EKG KG S K+G+R S TGE+V + VPEEN+L V +G+ + L+ R + Sbjct: 193 EKGYKGFSVAQKLDKLGMRGSHTGELVFQDCEVPEENVLGGVGRGVNVLMSGLDFERSVL 252 Query: 258 AWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGRMK 317 + G LG ++C + YV DRKQFG+ + QL+Q KLADM + + V +G+ Sbjct: 253 SGGPLGIMQACMDVVVPYVHDRKQFGQAIGEFQLMQGKLADMYSTMMACKAYVYAVGQAC 312 Query: 318 DEGTAAVEITSIMK------RNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVN 371 D +A ++ ++ K S KA +A A LGGNG +E+ V R + ++ Sbjct: 313 DRADSADKVRALRKDAAGAILYSAEKATWMAGEAIQSLGGNGYINEYPVGRLWRDAKLYE 372 Query: 372 TYEGTHDIHALILGR 386 GT +I +++GR Sbjct: 373 IGAGTSEIRRMLIGR 387 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 394 Length adjustment: 31 Effective length of query: 364 Effective length of database: 363 Effective search space: 132132 Effective search space used: 132132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory