Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate HSERO_RS05635 HSERO_RS05635 hypothetical protein
Query= reanno::SB2B:6938540 (460 letters) >FitnessBrowser__HerbieS:HSERO_RS05635 Length = 458 Score = 336 bits (861), Expect = 1e-96 Identities = 185/444 (41%), Positives = 265/444 (59%), Gaps = 9/444 (2%) Query: 10 SALQAMDAAHHLHPFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYG 69 SAL A+D H +HP T + + G +++ +G Y+ D + +LLDA +GLWCVN GYG Sbjct: 4 SALAALDRRHLIHPVTSLREHEELGPLILKSGQGAYLTDHQDKQLLDAFSGLWCVNTGYG 63 Query: 70 RKSIADAAYAQLQTLPFYNNFFQCTHEPAIRLASKIASLAPGHMNRVFFTGSGSEANDTN 129 ++S+ AA Q+Q LP+ +F EPAI LA K+ ++P + V+FT GS+A D Sbjct: 64 QESVIRAATEQMQRLPYATGYFHFASEPAILLAKKLVDISPASLQHVYFTLGGSDAVDAA 123 Query: 130 LRMVRRYWDLKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQGDLPIPGIVHIDQPY 189 +R + Y G P K+ IS + YHGS+ GA L + H +LP+P ++ PY Sbjct: 124 IRYITHYHHSIGKPGKQHFISLQRGYHGSSSVGAGLTALPNFHYHFNLPLPTQHYLPSPY 183 Query: 190 WFGEGRDMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNEIKR 249 + EA + QAL K+ ELG D VAAF EP QG+GGV++PP + ++ Sbjct: 184 PY-RSELQGDEAIIAASVQALRDKVAELGADNVAAFFCEPIQGSGGVVVPPKGWLKAMQL 242 Query: 250 ILEKYNILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDRVA 309 + +ILF++DEVI+GFGRTG FA ++PDL+T+AKG+T+GY PMG V++SDRV Sbjct: 243 ACNELDILFVVDEVITGFGRTGPMFACLDEDVQPDLMTMAKGLTAGYAPMGAVMMSDRVY 302 Query: 310 DVLISDGGEFA----HGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQT 365 + I+DG + HG TYS HPV+AAVALE +R+ EE L+D R P L+ Sbjct: 303 NG-IADGAPMSTVVGHGQTYSAHPVSAAVALEVLRLYEEGGLLDNGRR-LEPVFAGGLRA 360 Query: 366 LSAHPLVGEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTMI 425 L AHPLVG+ R G++GA+ELVADK + RF E+ +A GLV RA GD ++ Sbjct: 361 LLAHPLVGDARSRGLLGALELVADKQTKARFAPELKLHDRIFQAAYRHGLVFRAFGDNIL 420 Query: 426 -ISPPLCITRDEIDELIFKASQAL 448 +P LC T+++ L+F +A+ Sbjct: 421 GFAPALCYTQEDF-ALMFARLKAI 443 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 458 Length adjustment: 33 Effective length of query: 427 Effective length of database: 425 Effective search space: 181475 Effective search space used: 181475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory