Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (subunit 1/2) (EC 1.3.8.1) (characterized)
to candidate HSERO_RS04640 HSERO_RS04640 butyryl-CoA dehydrogenase
Query= BRENDA::D2RL84 (383 letters) >FitnessBrowser__HerbieS:HSERO_RS04640 Length = 382 Score = 342 bits (878), Expect = 8e-99 Identities = 168/377 (44%), Positives = 251/377 (66%) Query: 5 LTEDQQMIKDMAAEFAEKFLAPTVEERDKAHIWDRKLIDKMGEAGFCGICFPEEYGGMGL 64 L+ + +MI+D FA++ L P + D+ H + + + ++ E G G+C PE++GG G+ Sbjct: 3 LSPEHEMIRDAMRHFAQERLLPFAADWDRNHTFPAEALKELAELGAMGMCVPEQWGGAGM 62 Query: 65 DVLSYILAVEELSKVDDGTGITLSANVSLCATPIYMFGTEEQKQKYLAPIAEGTHVGAFG 124 D +S +LA+EE++ D T +S SL +G+ QK+++L P+A G +G F Sbjct: 63 DYMSLVLALEEIAAGDGATSTIVSVQNSLACGITEKYGSPTQKEQWLKPLARGEMLGCFC 122 Query: 125 LTEPSAGTDASAQQTTAVLKGDKYILNGSKIFITNGKEADTYVVFAMTDKSQGVHGISAF 184 LTEP G+DA+A +T A GD +ILNG+K FIT+GK A +VFA+TD+S G GIS F Sbjct: 123 LTEPHTGSDAAAIRTRAERDGDDFILNGTKQFITSGKHAGVAIVFAVTDRSAGKKGISCF 182 Query: 185 ILEKGMPGFRFGKIEDKMGGHTSITAELIFEDCEVPKENLLGKEGEGFKIAMETLDGGRI 244 ++ PGF G+ E+KMG H S T +++ ++C VP LLGKEGEG++IA+ L+ GRI Sbjct: 183 LVPCDTPGFVVGRSEEKMGQHASDTVQIMLDNCRVPATALLGKEGEGYRIALSNLEAGRI 242 Query: 245 GVAAQALGIAEGALAAAVKYSKEREQFGRSISKFQALQFMMADMATKIEAARYLVYHAAM 304 G+AAQ++G+A A AAV Y+++RE FG I + QA+ F +ADM T ++AAR +V+ AA Sbjct: 243 GIAAQSVGMARAAFEAAVSYARQRESFGVPIIEHQAVNFRLADMNTLLDAARLMVWRAAQ 302 Query: 305 LKNEGKPYSEAAAMAKCFASDVAMEVTTDAVQIFGGYGYTVDYPAERYMRNAKITQIYEG 364 LK++G+P + A+MAK FAS+ A ++ +DA+QI GG GYT D+P ER R+ +I QIYEG Sbjct: 303 LKDQGRPCLKEASMAKMFASEAAEKIASDAIQIHGGVGYTSDFPVERIYRDVRICQIYEG 362 Query: 365 TNQVMRIVTSRALLRDK 381 N + R+V RA+ D+ Sbjct: 363 ANDIQRLVIGRAIASDQ 379 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 382 Length adjustment: 30 Effective length of query: 353 Effective length of database: 352 Effective search space: 124256 Effective search space used: 124256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory