Align Indolepyruvate oxidoreductase subunit IorB; IOR; Indolepyruvate ferredoxin oxidoreductase subunit beta; EC 1.2.7.8 (characterized)
to candidate HSERO_RS21380 HSERO_RS21380 MFS transporter
Query= SwissProt::P80911 (196 letters) >FitnessBrowser__HerbieS:HSERO_RS21380 Length = 1199 Score = 65.1 bits (157), Expect = 5e-15 Identities = 58/197 (29%), Positives = 93/197 (47%), Gaps = 12/197 (6%) Query: 3 YNIYVCGVGGQGIIKTSVIIGEAAMNEGMNVVMSEIHGMAQRGGAVSTEIRFGD----VR 58 Y I V GVGG G+I II AA EG + ++ G+AQ+GG V + +R + + Sbjct: 746 YGILVTGVGGTGVITIGQIIAMAAHVEGRACSVLDMSGLAQKGGPVMSHVRVAEDAAHIH 805 Query: 59 GSIIPQGEADLVIAFEPL--EALRALPKMSEDAC-VIVNTSKIPPFNLIKSPHPYPPLEE 115 + + G ADLVI + + + AL +M E VN++++P +++P P Sbjct: 806 STRVGTGMADLVIGCDVIVTASRDALSRMGEGRTHAAVNSTQMPTAAFVRNPDWQFPTAS 865 Query: 116 IIKTLEENAGR--VRSFNGEKIAVE-AGHILSLNMVMLGAAAATTGFPLGEETLIESMKN 172 + GR + + +IA G ++ NM MLG A PL E L+ +++ Sbjct: 866 SEGEIARACGRDNLSLVDAGRIATALMGDAIATNMFMLGYAWQKGWVPLSEAALLRAIEL 925 Query: 173 NLPPKLMEVNLRAFHEG 189 N +E N +AF G Sbjct: 926 N--ALQVEFNKQAFAWG 940 Lambda K H 0.317 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 490 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 1199 Length adjustment: 33 Effective length of query: 163 Effective length of database: 1166 Effective search space: 190058 Effective search space used: 190058 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory