Align Aconitate isomerase; AI; EC 5.3.3.7 (uncharacterized)
to candidate HSERO_RS07335 HSERO_RS07335 molybdenum ABC transporter substrate-binding protein
Query= curated2:A0A0A1H8I4 (262 letters) >FitnessBrowser__HerbieS:HSERO_RS07335 Length = 262 Score = 255 bits (651), Expect = 7e-73 Identities = 138/248 (55%), Positives = 177/248 (71%), Gaps = 2/248 (0%) Query: 12 ALLLASTPLLAAQPVTTLTVLSSGGIMGTIREVAPAYEKATGVKLDIAAAPSMGDTPQAI 71 ALL+ +T LAA T + V+SSGG + +AP +EK TG KL PSMG+TPQAI Sbjct: 16 ALLIGATSALAA--ATDIHVVSSGGFAAAYKTLAPEFEKKTGHKLISGWGPSMGETPQAI 73 Query: 72 PNRLARNEPADVVLMVGSALDKLVASGQVAKDSRVDLGQSFIAMAVRQGAPKPDISNMDA 131 PNRL R E DVV+MVG +LDKLVA+G+V+K L S I +AV+ GAP+PDISN+DA Sbjct: 74 PNRLQRGEHIDVVIMVGDSLDKLVAAGKVSKTEHKLLALSRIGLAVKAGAPRPDISNLDA 133 Query: 132 FKQTLEKAQSVAYSDSASGVYLSRILFPRMQLDKSFMAKARMIPAEPVGAVVARGEAQLG 191 FK+TL A SV YSDSASGV+LS LF R+ +D+ K RMIPAEPVG VVARG+A++G Sbjct: 134 FKRTLLTAHSVVYSDSASGVFLSTKLFKRLGIDQQMAYKGRMIPAEPVGQVVARGDAEIG 193 Query: 192 FQQLSELKAVPGIDIVGLIPDQAQKMTLYSGAMVSKSQHPEAARALLQYLASKDAAKAIE 251 QQ+SELK V GIDI+G IP++AQ++T +S +V + EAA+ L+ +LAS +A AI+ Sbjct: 194 LQQISELKPVKGIDIIGPIPEEAQQLTPFSAGVVVGAHEAEAAKELVHFLASPEAQAAIK 253 Query: 252 DSGLKPVP 259 SGL P P Sbjct: 254 ASGLDPAP 261 Lambda K H 0.316 0.130 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 262 Length adjustment: 25 Effective length of query: 237 Effective length of database: 237 Effective search space: 56169 Effective search space used: 56169 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory