Protein 14712 in Escherichia coli BW25113
Annotation: FitnessBrowser__Keio:14712
Length: 458 amino acids
Source: Keio in FitnessBrowser
Candidate for 17 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-phenylalanine catabolism | aroP | hi | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs (characterized) | 100% | 100% | 912.1 | L-tyrosine transporter | 59% | 563.5 |
L-tryptophan catabolism | aroP | med | Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) | 64% | 95% | 599.7 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-tyrosine catabolism | aroP | med | Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) | 64% | 95% | 599.7 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
phenylacetate catabolism | H281DRAFT_04042 | med | Aromatic amino acid transporter AroP (characterized, see rationale) | 62% | 96% | 571.2 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
D-alanine catabolism | cycA | med | L-alanine and D-alanine permease (characterized) | 45% | 95% | 413.7 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-alanine catabolism | cycA | med | L-alanine and D-alanine permease (characterized) | 45% | 95% | 413.7 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-proline catabolism | proY | med | Proline-specific permease (ProY) (characterized) | 46% | 98% | 400.2 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-histidine catabolism | permease | med | histidine permease (characterized) | 45% | 95% | 394.8 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
D-serine catabolism | cycA | lo | D-serine/L-alanine/D-alanine/glycine/D-cycloserine uptake porter of 556 aas, CycA (characterized) | 38% | 81% | 330.9 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-serine catabolism | serP | lo | Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized) | 35% | 99% | 299.7 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-lysine catabolism | lysP | lo | lysine-specific permease (characterized) | 35% | 72% | 267.3 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-arginine catabolism | rocE | lo | Amino-acid permease GAP1 (characterized) | 36% | 73% | 264.6 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-isoleucine catabolism | Bap2 | lo | Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) | 34% | 89% | 250.8 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-leucine catabolism | Bap2 | lo | Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) | 34% | 89% | 250.8 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-valine catabolism | Bap2 | lo | Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) | 34% | 89% | 250.8 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-tryptophan catabolism | TAT | lo | valine/tyrosine/tryptophan amino-acid permease (characterized) | 32% | 70% | 219.2 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
L-tyrosine catabolism | TAT1 | lo | valine/tyrosine/tryptophan amino-acid permease (characterized) | 32% | 70% | 219.2 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 100% | 912.1 |
Sequence Analysis Tools
View 14712 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKNASTVSEDTASNQEPTLHRGLHNRHIQLIALGGAIGTGLFLGIGPAIQMAGPAVLLGY
GVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELT
AAGIYMQYWFPDVPTWIWAAAFFIIINAVNLVNVRLYGETEFWFALIKVLAIIGMIGFGL
WLLFSGHGGEKASIDNLWRYGGFFATGWNGLILSLAVIMFSFGGLELIGITAAEARDPEK
SIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNSSPFVMIFHNLDSNVVASALNFVI
LVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGVPINSLMLSGAITSLVVLINY
LLPQKAFGLLMALVVATLLLNWIMICLAHLRFRAAMRRQGRETQFKALLYPFGNYLCIAF
LGMILLLMCTMDDMRLSAILLPVWIVFLFMAFKTLRRK
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory