GapMind for catabolism of small carbon sources

 

Protein 16257 in Escherichia coli BW25113

Annotation: FitnessBrowser__Keio:16257

Length: 336 amino acids

Source: Keio in FitnessBrowser

Candidate for 17 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
D-galactose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
D-glucose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
lactose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
D-maltose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
sucrose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
trehalose catabolism mglC hi MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 100% 100% 646.4 ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose 40% 207.2
D-ribose catabolism rbsC med ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized) 40% 93% 207.2 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
myo-inositol catabolism PS417_11895 lo m-Inositol ABC transporter, permease component (iatP) (characterized) 36% 92% 206.5 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
D-fructose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 39% 90% 205.7 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
sucrose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 39% 90% 205.7 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
D-mannose catabolism HSERO_RS03645 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 36% 89% 198 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
D-xylose catabolism xylH lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 36% 99% 195.7 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
L-fucose catabolism HSERO_RS05255 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 37% 88% 188.3 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
D-mannose catabolism frcC lo Fructose import permease protein FrcC (characterized) 34% 85% 177.9 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
D-ribose catabolism frcC lo Fructose import permease protein FrcC (characterized) 34% 85% 177.9 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4
L-arabinose catabolism araH lo L-arabinose ABC transporter, permease protein AraH (characterized) 31% 91% 157.9 MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter 100% 646.4

Sequence Analysis Tools

View 16257 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSALNKKSFLTYLKEGGIYVVLLVLLAIIIFQDPTFLSLLNLSNILTQSSVRIIIALGVA
GLIVTQGTDLSAGRQVGLAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIG
LINGLIIAYLNVTPFITTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGS
FRLSYITFYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGV
FYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVIN
YGLTYIGVNPYWQYIIKGAIIIFAVALDSLKYARKK

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory