Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate 16413 b2306 histidine/lysine/arginine/ornithine transporter subunit (NCBI)
Query= TCDB::A3ZI83 (242 letters) >FitnessBrowser__Keio:16413 Length = 257 Score = 224 bits (570), Expect = 2e-63 Identities = 120/249 (48%), Positives = 164/249 (65%), Gaps = 14/249 (5%) Query: 6 NVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVNNLVL 65 +++K YG H VLK ++L G+ + IIG SGSGKST +RC+N LE+ S G +VVN + Sbjct: 10 DLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTI 69 Query: 66 N------------HKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAE 113 N KN++ + R MVFQHFNL+ HMTVL+N+ AP+++ SK+EA Sbjct: 70 NLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEAR 129 Query: 114 ETAFKYLKVVGLLDKAN-VYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQ 172 E A KYL VG+ ++A YP LSGGQQQRV+IAR+L + +LFDEPTSALDPE + Sbjct: 130 ERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVG 189 Query: 173 EVLDVMKEISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERA 232 EVL +M++++ + TMVVVTHEMGFA+ V+ +IF+ G I EE P + F NP++ R Sbjct: 190 EVLRIMQQLAEEGK-TMVVVTHEMGFARHVSTHVIFLHQGKIEEEGAPEQLFGNPQSPRL 248 Query: 233 RLFLGKILK 241 + FL LK Sbjct: 249 QRFLKGSLK 257 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 257 Length adjustment: 24 Effective length of query: 218 Effective length of database: 233 Effective search space: 50794 Effective search space used: 50794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory