Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate 16525 b2426 putative oxidoreductase (VIMSS)
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__Keio:16525 Length = 263 Score = 112 bits (281), Expect = 6e-30 Identities = 84/251 (33%), Positives = 124/251 (49%), Gaps = 10/251 (3%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGT----VATRADVS 67 G LI+G GIGE +A + GA + + D+S + D+ G A ADV Sbjct: 6 GKTALITGALQGIGEGIARTFARHGANLILLDISPE-IEKLADELCGRGHRCTAVVADVR 64 Query: 68 DAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHH 127 D A + A K +E G +D+LVNNAG+ +D +SD + I+IN+ + Sbjct: 65 DPASVAAAIKRAKEKEGRIDILVNNAGVCRLGSFLD-MSDDDRDFHIDINIKGVWNVTKA 123 Query: 128 AVPMLKESSHGHLLHIASVAGRL-GYAWRTPYAATKWAIVGLMKSLASELGESDIRVNAL 186 +P + G ++ ++SV G + T YA TK AIVGL KSLA E +S IRVNA+ Sbjct: 124 VLPEMIARKDGRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAI 183 Query: 187 LPGIVEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAAR 246 PG V P + + AR PE+ + E I ++R+ +V +A FL S + Sbjct: 184 CPGYVRTPMAESI--ARQSNPEDPESVL-TEMAKAIPMRRLADPLEVGELAAFLASDESS 240 Query: 247 NVTGQAISVDG 257 +TG +DG Sbjct: 241 YLTGTQNVIDG 251 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 6 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 263 Length adjustment: 25 Effective length of query: 237 Effective length of database: 238 Effective search space: 56406 Effective search space used: 56406 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory