Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate 17922 b3882 predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI)
Query= BRENDA::Q8ZLV8 (296 letters) >FitnessBrowser__Keio:17922 Length = 298 Score = 166 bits (420), Expect = 6e-46 Identities = 103/280 (36%), Positives = 148/280 (52%), Gaps = 3/280 (1%) Query: 5 VGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIIT 64 + FIGLG MG PM+ NLL+ G+ L V D N EA+ ++ GA A+ A+ + IIT Sbjct: 4 IAFIGLGQMGSPMASNLLQQGHQLRVFDVNAEAVRHLVDKGATPAANPAQAAKDAEFIIT 63 Query: 65 MLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPVSG 124 MLPN V+ V GENG+ EG ++IDMS+I PL + ++ ++AKG M+D PV Sbjct: 64 MLPNGDLVRNVLFGENGVCEGLSTDALVIDMSTIHPLQTDKLIADMQAKGFSMMDVPVGR 123 Query: 125 GEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVI-VALNI 183 AI GTL ++ GG ++ ++ AM +++ G G G KL N + +ALN Sbjct: 124 TSANAITGTLLLLAGGTAEQVERATPILMAMGSELINAGGPGMGIRVKLINNYMSIALN- 182 Query: 184 AAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAP-MVMDRNFKPGFRIDLHIKDL 242 A +EA L + D+ + + G AG P V+ + P F IDL KDL Sbjct: 183 ALSAEAAVLCEALNLPFDVAVKVMSGTAAGKGHFTTSWPNKVLSGDLSPAFMIDLAHKDL 242 Query: 243 ANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSAL 282 ALD ++ + +PL AA E+ RA G G D SA+ Sbjct: 243 GIALDVANQLHVPMPLGAASREVYSQARAAGRGRQDWSAI 282 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 298 Length adjustment: 26 Effective length of query: 270 Effective length of database: 272 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory