Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate 14934 b0809 glutamine ABC transporter ATP-binding protein (NCBI)
Query= reanno::Smeli:SMc02121 (258 letters) >FitnessBrowser__Keio:14934 Length = 240 Score = 254 bits (649), Expect = 1e-72 Identities = 128/240 (53%), Positives = 175/240 (72%), Gaps = 4/240 (1%) Query: 19 IEITNMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEEHQKGKIVVD 78 IE N++K +G VL +I+L + +GE +V+ GPSGSGKST++RCIN+LEE G ++VD Sbjct: 2 IEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVD 61 Query: 79 GIELTNDLKKIDE--VRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKEAEQVAMH 136 G+++ + K+DE +R+E GMVFQ F LFPHLT LEN P+ VR K+EAE++A Sbjct: 62 GLKVNDP--KVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLARE 119 Query: 137 FLERVKIPEQALKYPGQLSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEMVKEVLDTM 196 L +V + E+A YP +LSGGQQQRVAIAR+L ++PK++LFDEPTSALDPE+ EVL M Sbjct: 120 LLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVM 179 Query: 197 VGLAEEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFFDNPQHERTKLFLSQI 256 LAEEGMTM+ VTHE+GFA +VA+R+IF+D+G+I E +P NP +R + FL + Sbjct: 180 QDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGNPQVLIKNPPSQRLQEFLQHV 239 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 240 Length adjustment: 24 Effective length of query: 234 Effective length of database: 216 Effective search space: 50544 Effective search space used: 50544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory