Align histidine permease (characterized)
to candidate 1937132 b3795 predicted transporter (NCBI)
Query= reanno::pseudo3_N2E3:AO353_12275 (468 letters) >FitnessBrowser__Keio:1937132 Length = 461 Score = 373 bits (958), Expect = e-108 Identities = 190/451 (42%), Positives = 287/451 (63%), Gaps = 4/451 (0%) Query: 8 LKRGLSARHIRFMALGSAIGTGLFYGSASAIQMAGPAVLLAYLIGGAAVFMVMRALGEMA 67 L+RGL ARHI +ALG IG GLF G+AS ++ AGP+VLLAY+I G VF +MR++GEM Sbjct: 8 LQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIMRSMGEML 67 Query: 68 VHNPVAGSFGQYASTYLGPMAGFILGWTYAFEMVIVGMADVTAFGIYMGFWFPEVSRWIW 127 PV GSF YA Y+ P G++ W+Y F + VG++++TA G+Y+ FWFPE+++WI Sbjct: 68 FLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFPEMAQWIP 127 Query: 128 VLGVVSIVGGLNLCNVKVFGEMEFWLSLLKVAAIVAMILGGFGIMLFGISTAPGQVTDIS 187 L V++V NL V+++GE+EFW +++KV I+ MI+ G G++ FG GQ S Sbjct: 128 ALIAVALVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVIGLGVIFFGFGNG-GQSIGFS 186 Query: 188 NLWTQGGFMPNGMGGLIASFAVVMFAFGGIEIIGVTAGEAKDPQHVLPRAINAVPLRILL 247 NL GGF G G + + +V+ ++ G+E+IG+TAGEAK+PQ L A+ V RIL+ Sbjct: 187 NLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILI 246 Query: 248 FYVLTMLVLMSIFPWQQIGSQGSPFVQIFDKLGISSAATILNIVVITAAISAINSDIFGA 307 FYV + V+++IFPW +IGS GSPFV F K+GI++AA I+N VV+TAA+S NS ++ Sbjct: 247 FYVGAIFVIVTIFPWNEIGSNGSPFVLTFAKIGITAAAGIINFVVLTAALSGCNSGMYSC 306 Query: 308 GRMMFGLAQQGHAPKGFAHLSRNGVPWMTVVVMSVALLLGVLLNYLI--PENVFLLIASI 365 GRM++ LA+ P A +SR+GVP V V LL+G LNY+I P+ VF+ + S Sbjct: 307 GRMLYALAKNRQLPAAMAKVSRHGVPVAGVAVSIAILLIGSCLNYIIPNPQRVFVYVYSA 366 Query: 366 ATFATVWVWLMILFTQVAMRRSMTAEQVAQLKFPVPFWPYAPMAAIAFMLFVFGVLGYFP 425 + + W +IL +Q+ RR+ A +A F +P+A +AF++ V + + Sbjct: 367 SVLPGMVPWFVILISQLRFRRAHKA-AIASHPFRSILFPWANYVTMAFLICVLIGMYFNE 425 Query: 426 DTQAALIVGVVWIVLLVLAYLMWVKPAAGQA 456 DT+ +L VG+++++ + Y ++ G+A Sbjct: 426 DTRMSLFVGIIFMLAVTAIYKVFGLNRHGKA 456 Lambda K H 0.329 0.142 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 660 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 461 Length adjustment: 33 Effective length of query: 435 Effective length of database: 428 Effective search space: 186180 Effective search space used: 186180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory