Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate 14934 b0809 glutamine ABC transporter ATP-binding protein (NCBI)
Query= CharProtDB::CH_003736 (237 letters) >FitnessBrowser__Keio:14934 Length = 240 Score = 121 bits (304), Expect = 1e-32 Identities = 72/226 (31%), Positives = 117/226 (51%), Gaps = 3/226 (1%) Query: 5 MLSFDKVSAHYGKIQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRATSGRIVF 64 M+ F VS H+G Q LH + L+I QGE+V +IG +G+GK+TLL + TSG ++ Sbjct: 1 MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIV 60 Query: 65 DDKDITDWQT-AKIMREAVAIVPEGRRVFSRMTVEENLAMGGFFAERDQFQERIKWVYEL 123 D + D + +++R+ +V + +F +T EN+ G +E K EL Sbjct: 61 DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLAREL 120 Query: 124 FPR--LHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQIFDTIE 181 + L ER +SGG+QQ +AI RAL P+++L DEP+ L P + ++ ++ Sbjct: 121 LAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQ 180 Query: 182 QLREQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLAN 227 L E+GMT+ +V A K+A R ++ G + L+ N Sbjct: 181 DLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGNPQVLIKN 226 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 240 Length adjustment: 23 Effective length of query: 214 Effective length of database: 217 Effective search space: 46438 Effective search space used: 46438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory