Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate 16751 b2661 succinate-semialdehyde dehydrogenase I, NADP-dependent (NCBI)
Query= BRENDA::P42412 (487 letters) >FitnessBrowser__Keio:16751 Length = 482 Score = 256 bits (654), Expect = 1e-72 Identities = 150/449 (33%), Positives = 239/449 (53%), Gaps = 3/449 (0%) Query: 11 INGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVPRRAR 70 INGEW+++ + DV NPA + L VP ++ A A A W + RA Sbjct: 15 INGEWLDANNGEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRALPAWRALTAKERAT 74 Query: 71 ILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMGDSLASI 130 IL N+ L+ +H+++LA L+T+E GK EA GE+ +E+ A + GD++ Sbjct: 75 ILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFAEEGKRIYGDTIPGH 134 Query: 131 ATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLTEKLVE 190 D + PIGV I P+NFP + A+A G T +LKP+ +TP L E Sbjct: 135 QADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALAE 194 Query: 191 LFEKAGLPKGVFNVVYGAHDVV-NGILEHPEIKAISFVGSKPVGEYVYKKGSENLKRVQS 249 L +AG+P GVFNVV G+ V N + +P ++ +SF GS +G + ++ ++++K+V Sbjct: 195 LAIRAGVPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQLMEQCAKDIKKVSL 254 Query: 250 LTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQEKVA 309 G IV +DA+L+ V + + F +AG+ C+ + V++G+ D F KLQ+ V+ Sbjct: 255 ELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGVYDRFAEKLQQAVS 314 Query: 310 DIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDDGYFVGPTIF 369 + IG+GLD+GV +GP+I E + +I LE+GAR+VC G+ + G F PTI Sbjct: 315 KLHIGDGLDNGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKAH-ERGGNFFQPTIL 373 Query: 370 DNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAIRYFRENI 429 +V + K+E F P+ + R K+ + I AN +EF A + + + + E + Sbjct: 374 VDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYARDLSRVFRVGEAL 433 Query: 430 DAGMLGINLGVPAPMAFFPFSGWKSSFFG 458 + G++GIN G+ PF G K+S G Sbjct: 434 EYGIVGINTGI-ISNEVAPFGGIKASGLG 461 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 482 Length adjustment: 34 Effective length of query: 453 Effective length of database: 448 Effective search space: 202944 Effective search space used: 202944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory