Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate 16525 b2426 putative oxidoreductase (VIMSS)
Query= uniprot:A0A4R8NY47 (263 letters) >FitnessBrowser__Keio:16525 Length = 263 Score = 109 bits (272), Expect = 7e-29 Identities = 79/250 (31%), Positives = 121/250 (48%), Gaps = 8/250 (3%) Query: 17 LAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDAAVAPRFFPCN 76 L GK +ITG GIG + F GA + LDI+ E E L L + Sbjct: 4 LTGKTALITGALQGIGEGIARTFARHGANLILLDISPE-IEKLADELCGRGHRCTAVVAD 62 Query: 77 LMNLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAYWDERLAVNLRHQFFCAQ 136 + + ++ A + G +DIL+NNA D++ D + +N++ + + Sbjct: 63 VRDPASVAAAIKRAKEKEGRIDILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTK 122 Query: 137 AVLPGMRERKGGVILNFGSISWHLGL-PDLTLYMTAKAGIEGMTHGMARDFGRDGVRVNA 195 AVLP M RK G I+ S++ + P T Y KA I G+T +A ++ + G+RVNA Sbjct: 123 AVLPEMIARKDGRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNA 182 Query: 196 IIPGAIRTPRQTLL--WHTPEEEAKILA--AQCLPVR--VDPHDVAALALFLSSDSGAKC 249 I PG +RTP + PE+ +L A+ +P+R DP +V LA FL+SD + Sbjct: 183 ICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPMRRLADPLEVGELAAFLASDESSYL 242 Query: 250 TGREYYVDAG 259 TG + +D G Sbjct: 243 TGTQNVIDGG 252 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 263 Length adjustment: 25 Effective length of query: 238 Effective length of database: 238 Effective search space: 56644 Effective search space used: 56644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory