Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate Ga0059261_2556 Ga0059261_2556 ABC-type multidrug transport system, ATPase component
Query= CharProtDB::CH_088321 (255 letters) >FitnessBrowser__Korea:Ga0059261_2556 Length = 587 Score = 97.4 bits (241), Expect = 6e-25 Identities = 72/228 (31%), Positives = 124/228 (54%), Gaps = 19/228 (8%) Query: 6 ENLTVSYG-TDKV--LNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 ENL +G D+V ++D+S S+ TG IT L+GP+G GK+TL+ + LL P G + + Sbjct: 11 ENLFRCFGKNDEVVAIDDLSASIKTGIITGLVGPDGAGKTTLIRMIAGLLTPTRGKLTVN 70 Query: 63 D-NPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNAR--- 118 D P + + L ++L +PQ E +TV E L+L+ L D A+ Sbjct: 71 DLEPASQGDA--LRQQLGYMPQRFGLYEDLTVLEN--------LTLYSDLRGVDPAKRAD 120 Query: 119 -VNVAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDL 177 + T + RR +LSGG +Q+ LA L + V+LLDEP+ +D + +L Sbjct: 121 MFERMLEFTDLKRFTERRAGKLSGGMKQKLGLACTLLGDPQVLLLDEPSVGVDPISRREL 180 Query: 178 MRLMGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEV 225 +++G+L +GKT++ L++A R C +++++ +G + G+P+E+ Sbjct: 181 WKMVGDLAGEGKTIIWSTAYLDEAER-CPEVILLDHGKPLYCGSPDEL 227 Score = 77.8 bits (190), Expect = 5e-19 Identities = 53/225 (23%), Positives = 108/225 (48%), Gaps = 6/225 (2%) Query: 1 MTLRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVF 60 + + ++LT +G +DVS + G+I L+GPNG GKST LL+P SG Sbjct: 334 VVIEAKHLTKRFGDFAATDDVSFDVKRGEIYGLLGPNGAGKSTTFKMLCGLLVPSSGDAN 393 Query: 61 LGDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVN 120 + + S +RL + Q ++V++ + + + ++G ++ R++ Sbjct: 394 VLGYSLKR-SPGDARQRLGYMAQKFSLYGTLSVRQNMEF----FAGIYGLDGSDRRERID 448 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 ++ + L G +QR LA + + ++ LDEPT+ +D + + Sbjct: 449 AMIDAFALKPYLAMSPDALPLGFKQRLALACAIMHDPAILFLDEPTSGVDPLTRREFWTH 508 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEV 225 + + +G TV+ H +++A YCD++ ++ G ++A G P+++ Sbjct: 509 INGVVEKGVTVMVTTHFMDEA-EYCDRIGLIYRGKLIASGAPDDL 552 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 255 Length of database: 587 Length adjustment: 30 Effective length of query: 225 Effective length of database: 557 Effective search space: 125325 Effective search space used: 125325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory