Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate Ga0059261_0812 Ga0059261_0812 Short-chain alcohol dehydrogenase of unknown specificity
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__Korea:Ga0059261_0812 Length = 253 Score = 133 bits (335), Expect = 3e-36 Identities = 93/255 (36%), Positives = 132/255 (51%), Gaps = 20/255 (7%) Query: 4 RLAGKTALITAAGQGIGLATAELFAREGARVIATDIR-------IDGLAGKPVEARKLDV 56 RL GK A+IT A GIG A A FA EGA+++ R D L G+ DV Sbjct: 3 RLDGKVAIITGASSGIGEAAARRFAAEGAKLVLAARRPAELERVADELGGETAFLAG-DV 61 Query: 57 RDDAAIKALAA----EIGAVDVLFNCAGFVH-AGNILECSEEDWDFAFDLNVKAMYRMIR 111 RD+A +AL A G +D+ FN AG V +G + + EDW + N+ A + + Sbjct: 62 RDEAYAEALVALAVERFGGLDIAFNNAGAVGVSGPLTGLAAEDWGWTIATNLTAAFYGAK 121 Query: 112 AFLPAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNA 171 AM +GGGSI+ SS + G+P AY+A+KA ++GL +++A + + VR NA Sbjct: 122 HQAAAMAARGGGSILFSSSFVGAANGIPGMGAYAAAKAGLLGLVRTLAVELGPQRVRANA 181 Query: 172 ICPGTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDES 231 + G +P A + Q VQA + R+ +PEEIA +AL+L SD + Sbjct: 182 LIIGGTDTP-------ASSARQPDADPGVQAWMEQLHALKRLAEPEEIAEMALFLASDAA 234 Query: 232 SFTTGHAHVIDGGWS 246 SF TG A +DGG S Sbjct: 235 SFVTGGAIAVDGGAS 249 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 253 Length adjustment: 24 Effective length of query: 223 Effective length of database: 229 Effective search space: 51067 Effective search space used: 51067 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory