Align Short-chain alcohol dehydrogenase protein (characterized, see rationale)
to candidate Ga0059261_2792 Ga0059261_2792 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= uniprot:D8IS13 (254 letters) >FitnessBrowser__Korea:Ga0059261_2792 Length = 246 Score = 137 bits (346), Expect = 2e-37 Identities = 88/249 (35%), Positives = 134/249 (53%), Gaps = 12/249 (4%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKPHLDELAGIAGVETHLLDVTDD 66 +LAG+ +LIT AA GIGRA+ ELFAREGA + D S L A +G L D+ D+ Sbjct: 2 KLAGRRILITGAASGIGRATAELFAREGAALALLDRSDDLLRSAAQASGGTAVLADLADE 61 Query: 67 AAIKALVAK----IGTIDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLP 122 A + A VAK +G ID + N AG + + D ++WD +N A + RA LP Sbjct: 62 AQLLAAVAKAAQAMGGIDGIVNGAGIAGSQPLDALDRESWDRFVAINLTAPYLICRAALP 121 Query: 123 GMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVAQGIRCNAICPG 182 + +IVNIAS + + AY A+KA +V TK++ A+ +A IR N + PG Sbjct: 122 HLQVTGNATIVNIASGQALLPNAPGIAAYAATKAGLVAFTKALGAE-LAPRIRANVVAPG 180 Query: 183 TIESPSLNQRISTQAKETGKSEEEVRAAFVGRQPMGRIGKAEEVAALALYLASDESNFTT 242 +++P + + A+ A FV + M R+ + E+A L+L+S+ S++ T Sbjct: 181 IVDTPMVQGVLGGYARPDD-------APFVQQYAMKRVARPSELAEAILFLSSEASSYVT 233 Query: 243 GSIHMIDGG 251 G++ +DGG Sbjct: 234 GTVLAVDGG 242 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 246 Length adjustment: 24 Effective length of query: 230 Effective length of database: 222 Effective search space: 51060 Effective search space used: 51060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory