Align L-fuconate dehydratase; L-rhamnonate dehydratase (EC 4.2.1.68; EC 4.2.1.90) (characterized)
to candidate Ga0059261_2974 Ga0059261_2974 Altronate dehydratase
Query= reanno::BFirm:BPHYT_RS34230 (431 letters) >FitnessBrowser__Korea:Ga0059261_2974 Length = 490 Score = 174 bits (442), Expect = 4e-48 Identities = 140/411 (34%), Positives = 190/411 (46%), Gaps = 35/411 (8%) Query: 2 PVAAQQPTLEGYLRGDGRKGIRNVVAVAYLVECAHHVAREIVTQFREPLDAFDDPSAERE 61 P AA GY R DGR G RN + + V C A++I + L A D Sbjct: 98 PAAASAIKWRGYPRADGRAGTRNEIWILPTVGCVGRTAQKIAVKAEALLPAGVDG----- 152 Query: 62 PPVHLIGFP-GCYPNGY----AEKMLERLTTHPNVGAVLFVSLGCESMNKHYLVDVVRAS 116 VH P GC +L L HPN G VL V LGCES L++ + Sbjct: 153 --VHAFAHPFGCSQLSDDLDGTRNILSALAQHPNAGGVLLVGLGCESNQLSALLETLPED 210 Query: 117 GRPVEVLTIQEKGGTRSTIQYGVDWIRGAREQLAAQQKVPMALSELVIGTICGGSDGTSG 176 R + V T+ + I GV + + A Q+ M L LV+G CGGSDG SG Sbjct: 211 VR-MRVRTVGAQSSP-DEIGEGVGKVLELAQLAATAQREEMGLDRLVLGVKCGGSDGLSG 268 Query: 177 ITANPAVGRAFDHLIDAGATCIFEETGELVGCEFHMKTRAARPALGDEIVACVAKAARYY 236 +TANP VG D + DAG + I E E+ G E + RAA D I A V + RY+ Sbjct: 269 LTANPLVGIMADRITDAGGSAILTEIPEIFGAEQLLMARAADADTFDAIGALVNRFKRYF 328 Query: 237 SILGHG-----SFAVGNADGGLTTQEEKSLGAYAKSGASPIVGIIKPGDIPPTGGLYLLD 291 + HG + + GN GG+TT EEKSLGA K G + + +I GD GL LL+ Sbjct: 329 --IDHGEPVSENPSPGNIAGGITTLEEKSLGAVQKGGQAIVTDVIDYGDRVKRTGLTLLE 386 Query: 292 VVPDGEPRFGFPNISDNAEIGELIACGAHVILFTTGRGSVVGSAISPVIKVCANPATYRN 351 G +S A L A GA VILFTTGRG+ +G +P +K+ +N Sbjct: 387 AP-------GNDAVSSTA----LSAAGATVILFTTGRGTPLGFP-APTLKIASNSDLAAR 434 Query: 352 LSGDMDVDAGRILEGRGTLDEVGREVFEQTVAVSRGAASKSETLGHQEFIL 402 G +D DAG++L +D + + A++ G + +E G +E + Sbjct: 435 KPGWIDFDAGQVL--TDGMDVAADALLARIAAIASGEEAAAERNGEREIAI 483 Lambda K H 0.318 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 490 Length adjustment: 33 Effective length of query: 398 Effective length of database: 457 Effective search space: 181886 Effective search space used: 181886 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory