Align arylformamidase (EC 3.5.1.9) (characterized)
to candidate Ga0059261_4138 Ga0059261_4138 alpha/beta hydrolase fold
Query= metacyc::MONOMER-19505 (304 letters) >FitnessBrowser__Korea:Ga0059261_4138 Length = 292 Score = 75.9 bits (185), Expect = 1e-18 Identities = 66/218 (30%), Positives = 92/218 (42%), Gaps = 15/218 (6%) Query: 54 YGPHPAELL--DYFPATGRSDAPLLVFVHGGNWQALGRAESAFAVPALLAAGAAVAVVEY 111 Y HP L D G+ AP+LV +HGG W R +S + + AG A+ V+Y Sbjct: 41 YATHPTGPLHLDLHRPAGKGRAPVLVVLHGGGWARGERPKSWAGLRPFVEAGYAIVSVQY 100 Query: 112 GLAPDTPLEAMAGMVRRSVAWLLRHADALGFAPDRLHLCGTSAGAHLAAMA--LLPHPDD 169 L+ A R ++AW+ R+AD P RL + GTSAG HLA MA L D Sbjct: 101 RLSGTAQAPAAVQDARCAMAWVARNADRHQLDPRRLVVLGTSAGGHLALMAGMLGGRADI 160 Query: 170 GPDTSGRIAGAVLLSGIY---DLEPVQLSYVN--DALRLDGAG------ARRNSPLLRLP 218 G + A + Y DL P L + G G A R SPL + Sbjct: 161 DLPACGPVPRAAAIIDFYGPTDLRPESLGKWRSPSVTKWIGEGPDAPALAERMSPLTLVR 220 Query: 219 PRLPPLVVARGDNETEEYVRQHEQMVAALRARAAVTEV 256 P+ + GD + ++ Q+ AAL +E+ Sbjct: 221 KGQVPVFIVHGDADNVVPIQSSRQLKAALDRAGVPSEL 258 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 292 Length adjustment: 26 Effective length of query: 278 Effective length of database: 266 Effective search space: 73948 Effective search space used: 73948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory