Align Arabinose-proton symporter; Arabinose transporter (characterized)
to candidate BWI76_RS21205 BWI76_RS21205 MFS transporter
Query= SwissProt::P96710 (464 letters) >FitnessBrowser__Koxy:BWI76_RS21205 Length = 478 Score = 292 bits (747), Expect = 2e-83 Identities = 161/452 (35%), Positives = 261/452 (57%), Gaps = 12/452 (2%) Query: 20 MGFVILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLS-PFMEGLVISSIMIGGVVGVG 78 MG+V I A GGLL+GYD VI GA F + +S++ P G +SS ++G V G Sbjct: 10 MGYVWTICLVAACGGLLFGYDWVVIGGAKPFYEAWFSITDPAQSGWAMSSALVGCVFGAL 69 Query: 79 ISGFLSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARIIGGLGIGMGSSLSVTYI 138 ISG+ +D+ GR+ L+ +A+LF+ SA +A++ ++ RI+GG+GIG+ S+LS YI Sbjct: 70 ISGWCADKLGRKLPLILSAVLFSASAWGTAVASSFDMFVVYRIVGGVGIGLASALSPLYI 129 Query: 139 TEAAPPAIRGSLSSLYQLFTILGISATYFINL---------AVQRSGTYEWGVHTGWRWM 189 E +P RG ++ QL ++G+ A INL A Q+ W GWRWM Sbjct: 130 AEVSPAEKRGRFVAVNQLTIVIGVLAAQLINLMIAEPVATGATQQMIVETWNGQMGWRWM 189 Query: 190 LAYGMVPSVIFFLVLLVVPESPRWLAKAGKTNEALKILTRINGETVAKEELKNIENSL-K 248 +VP++ F +++ VPESPRWL KAGK A L RI A L++I ++L K Sbjct: 190 FGAELVPALAFLVLMFFVPESPRWLMKAGKPERARAALERIGSADYADRILRDIAHTLEK 249 Query: 249 IEQMGSLSQLFKPGLRKALVIGILLALFNQVIGMNAITYYGPEIFKMMGFGQNAGFVTTC 308 S L P ++ ++IG++LA+F Q G+N I Y EIF GF N+ + Sbjct: 250 DNHKVSYGALLAPQVKPIVIIGMVLAVFQQWCGINVIFNYAQEIFASAGFDINSTLKSIV 309 Query: 309 IVGVVEVIFTVIAVLLIDKVGRKKLMSIGSAFMAIFMILIGTSFYFELTSGIMMIVLILG 368 GVV ++FT+ A+ L+DK+GR+KLM +G++ + + +LI ++ + G +++L+L Sbjct: 310 ATGVVNLVFTLAALPLVDKIGRRKLMLLGASGLTLIYVLIAGAYAMGI-MGWPVLLLVLA 368 Query: 369 FVAAFCVSVGPITWIMISEIFPNHLRARAAGIATIFLWGANWAIGQFVPMMIDSFGLAYT 428 +A + +++ P+TW++++EIFPN +R A + T+ LW A + + P++ G A + Sbjct: 369 AIAIYALTLAPVTWVLLAEIFPNRVRGLAMSLGTLALWIACFLLTYTFPLLNAGLGAAGS 428 Query: 429 FWIFAVINILCFLFVVTICPETKNKSLEEIEK 460 F ++ VI +L+++ PETK +LE +E+ Sbjct: 429 FLLYGVICAAGYLYILRNVPETKGVTLEALEE 460 Lambda K H 0.327 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 478 Length adjustment: 33 Effective length of query: 431 Effective length of database: 445 Effective search space: 191795 Effective search space used: 191795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory