Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate BWI76_RS00280 BWI76_RS00280 ribose ABC transporter permease
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Koxy:BWI76_RS00280 Length = 321 Score = 175 bits (443), Expect = 2e-48 Identities = 112/289 (38%), Positives = 160/289 (55%), Gaps = 14/289 (4%) Query: 24 TQFPGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKVIGDF 83 T P F + + NIL + I+AVGMT VIL+ GIDLSVGS++A TG A ++G Sbjct: 35 TMSPNFFTVNNLFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVG-I 93 Query: 84 GLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINH 143 ++ L+A L +G A GA G+++ ++ AFI TL M LRGV+ + + S P+N Sbjct: 94 EVNALVAVAAALALGAAIGAVTGVIVAKGRVQAFIATLVMMLLLRGVTMVYTNGS-PVNT 152 Query: 144 PIYDTLSSLAWKIPGGGRLSAMGL-----LMLAVVVIGIFLAHRTRFGNQVYAIGGNATS 198 D W G GR +G+ +M V + ++ H TR G +YA+GGN + Sbjct: 153 GFTDNADLFGWF--GIGR--PLGIPTPVWIMAIVFLAAWYMLHHTRLGRYIYALGGNEAA 208 Query: 199 ANLMGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLL 258 L GIS I +Y L LA+LAGI+ + AG G ELDAIA+VV+GGT L Sbjct: 209 TRLSGISVNKVKIIVYSLCGMLASLAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSL 268 Query: 259 SGGVGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKI--AIGILLFIFI 305 +GG G ++GTL G I G + +N G +SS++ I A+ ILL + + Sbjct: 269 AGGKGRIVGTLIGALILGFLNNGLNLLG-VSSYYQMIVKAVVILLAVLV 316 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 321 Length adjustment: 28 Effective length of query: 303 Effective length of database: 293 Effective search space: 88779 Effective search space used: 88779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory