Align aquaglyceroporin (characterized)
to candidate BWI76_RS23100 BWI76_RS23100 aquaporin
Query= CharProtDB::CH_024677 (281 letters) >FitnessBrowser__Koxy:BWI76_RS23100 Length = 266 Score = 392 bits (1006), Expect = e-114 Identities = 180/263 (68%), Positives = 219/263 (83%) Query: 6 TLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGA 65 +LK QC AEFLGTGL +FFG+GC++ALKVAGAS G WEI +IWGLG+++A+YLT+G+SG Sbjct: 4 SLKAQCTAEFLGTGLFLFFGIGCLSALKVAGASLGLWEICIIWGLGISLAVYLTSGISGG 63 Query: 66 HLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGS 125 HLNPAVT+ALWLFACF RKV P+IVSQVAGAF A L Y LY +F +FE HHI RGS Sbjct: 64 HLNPAVTVALWLFACFPGRKVFPYIVSQVAGAFGGAVLAYVLYSTMFTEFESAHHIARGS 123 Query: 126 VESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGL 185 VES+ LA FSTYP ++ A VE+VIT++LMG+I+ALTDDGNGVP+GPLAPLLIGL Sbjct: 124 VESLQLASIFSTYPAASLSIWHAALVEVVITSMLMGMIMALTDDGNGVPKGPLAPLLIGL 183 Query: 186 LIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAI 245 L+AVIGAS GPLTGFAMNPARDFGPK+F W+AGWG++A TGGRDIPYF+VP+ P++GA Sbjct: 184 LVAVIGASTGPLTGFAMNPARDFGPKLFTWMAGWGDIAMTGGRDIPYFIVPIIAPLIGAC 243 Query: 246 VGAFAYRKLIGRHLPCDICVVEE 268 +GA YR LIG +LPC+ C +E+ Sbjct: 244 LGAAIYRYLIGNNLPCNTCKLED 266 Lambda K H 0.327 0.143 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 266 Length adjustment: 25 Effective length of query: 256 Effective length of database: 241 Effective search space: 61696 Effective search space used: 61696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory