Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate BWI76_RS17830 BWI76_RS17830 ABC transporter ATP-binding protein
Query= TCDB::G3LHY8 (358 letters) >FitnessBrowser__Koxy:BWI76_RS17830 Length = 364 Score = 186 bits (471), Expect = 1e-51 Identities = 108/306 (35%), Positives = 170/306 (55%), Gaps = 5/306 (1%) Query: 4 LRNAAKMVGADYHIYPTDLVLERGTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFDGT 63 L + K G + I L + G VL+GP+ GK++L+R++AGL+ +GG +H + Sbjct: 6 LNSVRKSYGDAHVIKDVSLTIPDGEFCVLVGPSGCGKSTLLRMIAGLEEISGGEVHINER 65 Query: 64 DVTGMPVQKRNVAMVYQQFINYPALTVYNNIASPMRISGKDAATIDREVRKAAELLKLTP 123 +VT + + R++AMV+Q + YP +TV N+ ++++ A I+++V +AA LL L P Sbjct: 66 NVTEVEPKLRDIAMVFQSYALYPQMTVRENMGFALKMAKLPKAEINQKVNEAAALLGLEP 125 Query: 124 YLDRTPLNLSGGQQQRTALARALVKNASLVLMDEPLANLDYKLREELREELPKIFAQSGA 183 L+R P +LSGGQ+QR A+ RA+V+ + L DEPL+NLD KLR ++R E+ ++ + Sbjct: 126 LLERLPKDLSGGQRQRVAMGRAIVRKPQVFLFDEPLSNLDAKLRTQVRGEIRELHRRLKT 185 Query: 184 IFVYATTEPSEALLLGGNTATLNQGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTL--D 241 VY T + EA+ +G L GR+ Q G +E+Y RP NL AG P +N L + Sbjct: 186 TSVYVTHDQIEAMTMGQMIVVLRDGRIEQAGTPLELYDRPANLFVAGFIGSPEINQLPGE 245 Query: 242 VTKSGNV--FTRPSGVTIPVPSHLAVVPDGPVTIAFHPHHLGLAPQTGDAARLQARTLVS 299 V +GN G + +P+ L V V A P + + + D A L A+ Sbjct: 246 VVLNGNATSLRLKDGSLLALPAGLRVTDGQQVVYAIRPEQVNVVHEARDDA-LAAKVTAV 304 Query: 300 EITGSE 305 E TGS+ Sbjct: 305 ENTGSD 310 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 364 Length adjustment: 29 Effective length of query: 329 Effective length of database: 335 Effective search space: 110215 Effective search space used: 110215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory