Align ABC transporter for Lactose, ATPase component (characterized)
to candidate BWI76_RS26290 BWI76_RS26290 glycerol-3-phosphate ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >FitnessBrowser__Koxy:BWI76_RS26290 Length = 356 Score = 336 bits (862), Expect = 5e-97 Identities = 182/357 (50%), Positives = 246/357 (68%), Gaps = 11/357 (3%) Query: 1 MSELQLSDVRKSYGG-LEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGD 59 M+ L+L V KS+ G +VI+ + LD+ GEF+V VGPSGCGKSTLLRM+AGLE ++SGD Sbjct: 1 MAGLKLQAVTKSWDGKTQVIQPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTSGD 60 Query: 60 LTIDDVRMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNEAAH 119 + ID R+ +++P RGIAMVFQ+YALYPHM+V ENM + L+ G+ + I +RV EAA Sbjct: 61 IWIDRKRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGLGKGLIAERVQEAAR 120 Query: 120 ILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEIARL 179 ILEL LL R+P++LSGGQRQRVA+GRAIVR P +FLFDEPLSNLDA+LRV MR+E+ L Sbjct: 121 ILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQHL 180 Query: 180 HKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGSPKM 239 H++L TT +YVTHDQVEAMTLA +++VM GV EQ+G+P+++Y+ PA+ FVA FIGSP M Sbjct: 181 HRRLKTTSLYVTHDQVEAMTLAQRVMVMNKGVAEQIGTPVEVYEKPASRFVASFIGSPAM 240 Query: 240 NFLKGVIEIDEDQAYARLPDYGDAKIPVTLQ--AAAGTAVTIGIRPEHFDEAGPA--ALD 295 N L+G + D +R G +P+ + AG +T+GIRPEHF + A + Sbjct: 241 NLLEGRVSDDG----SRFELAGGMLLPINSEHRRYAGRKMTLGIRPEHFALSSQAEGGVP 296 Query: 296 LAIDMLEHLGGETFAYARHHGNGELIVVETKNGRGLKTGDRLTARFDPVSVLVFDGE 352 L +D LE LG + A+ R + +VV + + + G L S+ +FD E Sbjct: 297 LVMDTLEILGADNLAHGR--WGEQKLVVRLPHQQRPQAGSTLWLHLPQESLHLFDSE 351 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 356 Length adjustment: 29 Effective length of query: 329 Effective length of database: 327 Effective search space: 107583 Effective search space used: 107583 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory