Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate BWI76_RS17830 BWI76_RS17830 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Koxy:BWI76_RS17830 Length = 364 Score = 311 bits (796), Expect = 2e-89 Identities = 182/380 (47%), Positives = 245/380 (64%), Gaps = 26/380 (6%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M ++ L+++ K Y +A + +++ +L I D EF V VGPSGCGKST LRMIAGLE+I+ G Sbjct: 1 MGSVVLNSVRKSYGDA--HVIKDVSLTIPDGEFCVLVGPSGCGKSTLLRMIAGLEEISGG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 ++I+++ + + PK RDIAMVFQ+YALYP M+V ENM F LK+ K K +IN++V+EAA Sbjct: 59 EVHINERNVTEVEPKLRDIAMVFQSYALYPQMTVRENMGFALKMAKLPKAEINQKVNEAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 +LGL LER P DLSGGQRQRVAMGRAIVR +VFL DEPLSNLDAKLR +R EI + Sbjct: 119 ALLGLEPLLERLPKDLSGGQRQRVAMGRAIVRKPQVFLFDEPLSNLDAKLRTQVRGEIRE 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +HRR+ T++YVTHDQ EAMT+ IV++ GRIEQ GTP ELY+ PAN Sbjct: 179 LHRRLKTTSVYVTHDQIEAMTMGQMIVVLRD----------GRIEQAGTPLELYDRPANL 228 Query: 241 FVAGFIGSPAMNFFEVTV----EKERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIR 296 FVAGFIGSP +N V L +DG LALP G ++ + G++V IR Sbjct: 229 FVAGFIGSPEINQLPGEVVLNGNATSLRLKDGSLLALPAGL-RVTD-----GQQVVYAIR 282 Query: 297 PEDISSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKV 356 PE ++ +VHE +A + A + E GS+ L+ G FT+ R + G+K+ Sbjct: 283 PEQVN---VVHEARDDA-LAAKVTAVENTGSDMQLFCDTGGGAFTSVFKQRLAVKEGDKI 338 Query: 357 QLTFNIAKGHFFDLETEKRI 376 L ++ H FD ++ +RI Sbjct: 339 WLQPKLSGVHLFDAQSGQRI 358 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 364 Length adjustment: 30 Effective length of query: 347 Effective length of database: 334 Effective search space: 115898 Effective search space used: 115898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory