Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized)
to candidate BWI76_RS17830 BWI76_RS17830 ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3039 (367 letters) >FitnessBrowser__Koxy:BWI76_RS17830 Length = 364 Score = 335 bits (859), Expect = 1e-96 Identities = 180/357 (50%), Positives = 244/357 (68%), Gaps = 8/357 (2%) Query: 1 MANLKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSGGTI 60 M ++ + +++K + +IK + L + D EF V VGPSGCGKSTLLR+IAGLEE+SGG + Sbjct: 1 MGSVVLNSVRKSYGDAHVIKDVSLTIPDGEFCVLVGPSGCGKSTLLRMIAGLEEISGGEV 60 Query: 61 ELDGRDITEVSPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVAKAEVEKKVSEAARI 120 ++ R++TEV P RD+AMVFQ+YALYP M+VR+NM FAL +A + KAE+ +KV+EAA + Sbjct: 61 HINERNVTEVEPKLRDIAMVFQSYALYPQMTVRENMGFALKMAKLPKAEINQKVNEAAAL 120 Query: 121 LELGPMLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELLRLH 180 L L P+LER PK LSGGQRQRVA+GRAIVR P++FLFDEPLSNLDA LR Q+R E+ LH Sbjct: 121 LGLEPLLERLPKDLSGGQRQRVAMGRAIVRKPQVFLFDEPLSNLDAKLRTQVRGEIRELH 180 Query: 181 KELQATMIYVTHDQVEAMTMADKVVVLNGGKIEQVGSPLDLYHQPANLFVAGFLGTPKMG 240 + L+ T +YVTHDQ+EAMTM +VVL G+IEQ G+PL+LY +PANLFVAGF+G+P++ Sbjct: 181 RRLKTTSVYVTHDQIEAMTMGQMIVVLRDGRIEQAGTPLELYDRPANLFVAGFIGSPEIN 240 Query: 241 FLKGKITRVDSQGCEVQLDAGTRVSLPLGGRHLSVGSAVTLGIRPEHLELA-KPGDCALQ 299 L G++ ++ ++L G+ ++LP G R ++ G V IRPE + + + D AL Sbjct: 241 QLPGEVV-LNGNATSLRLKDGSLLALPAGLR-VTDGQQVVYAIRPEQVNVVHEARDDALA 298 Query: 300 VTADVSERLGSD--TFCHVRTASGEALTMRVRGDLASRYGETLSLHLDAQHCHLFDA 354 E GSD FC G A T + LA + G+ + L HLFDA Sbjct: 299 AKVTAVENTGSDMQLFC---DTGGGAFTSVFKQRLAVKEGDKIWLQPKLSGVHLFDA 352 Lambda K H 0.320 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 364 Length adjustment: 30 Effective length of query: 337 Effective length of database: 334 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory