Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate BWI76_RS05975 BWI76_RS05975 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >FitnessBrowser__Koxy:BWI76_RS05975 Length = 231 Score = 229 bits (584), Expect = 3e-65 Identities = 121/233 (51%), Positives = 165/233 (70%), Gaps = 2/233 (0%) Query: 1 MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRY 60 MLS ++ +YG IQ L V +++ EIVTLIG+NGAGK++ L + ++ +G + + Sbjct: 1 MLSARELKVFYGVIQGLKGVDIDIHDREIVTLIGSNGAGKTSTLNGIVNLVRS-TGRVNF 59 Query: 61 EGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELF 120 E++ + I+RK +A+VPEGRR+F+ LT+EENL MG + + + D++ LF Sbjct: 60 LNEDISRSQTHQIVRKGLALVPEGRRIFTNLTIEENLRMGAY-NNLAGFPRLRDRMYSLF 118 Query: 121 PRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLR 180 PRLKER Q AGTMSGGEQQMLAI RALMS+P LL+LDEPSLGLAP I+ ++F I+QLR Sbjct: 119 PRLKERRTQMAGTMSGGEQQMLAIARALMSEPVLLMLDEPSLGLAPKIVGELFATIKQLR 178 Query: 181 REGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGG 233 E +TV LVEQNA AL +ADRAYVLENG+I++ A +L NP+++ YLGG Sbjct: 179 EENITVLLVEQNATAALTIADRAYVLENGKIMLSGPAAEVLANPEIKRMYLGG 231 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 231 Length adjustment: 23 Effective length of query: 210 Effective length of database: 208 Effective search space: 43680 Effective search space used: 43680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory