Align fructokinase; EC 2.7.1.4 (characterized)
to candidate BWI76_RS07325 BWI76_RS07325 aminoimidazole riboside kinase
Query= CharProtDB::CH_006622 (307 letters) >FitnessBrowser__Koxy:BWI76_RS07325 Length = 307 Score = 540 bits (1391), Expect = e-158 Identities = 273/307 (88%), Positives = 286/307 (93%) Query: 1 MNAKVWVLGDAVVDLLPESEGRLLQCPGGAPANVAVGVARLGGNSGFIGAVGGDPFGRYM 60 M AKVWVLGDAVVDLLPESEGRLL+CPGGAPANVAVG+ARLGG SGFIG VG DPFGR+M Sbjct: 1 MIAKVWVLGDAVVDLLPESEGRLLRCPGGAPANVAVGIARLGGISGFIGRVGDDPFGRFM 60 Query: 61 RHTLQQEQVDVSHMYLDDQHRTSTVVVDLDDQGERTFTFMVRPSADLFLVEEDLPQFAAG 120 RHTLQQE VDVSHM LD +HRTSTVVVDLDDQGERTFTFMVRPSADLFL +EDLPQFAA Sbjct: 61 RHTLQQELVDVSHMRLDGEHRTSTVVVDLDDQGERTFTFMVRPSADLFLAKEDLPQFAAN 120 Query: 121 QWLHVCSIALSAEPSRSTTFAAMESIRSAGGRVSFDPNIRPDLWQDQALLLACLDRALHM 180 QWLHVCSIALSAEPSRSTTFAAME I+ AGGRVSFDPNIRPDLWQDQ LL ACLDRAL M Sbjct: 121 QWLHVCSIALSAEPSRSTTFAAMEKIKLAGGRVSFDPNIRPDLWQDQELLHACLDRALRM 180 Query: 181 ANVVKLSEEELVFISSSNDLAYGIASVTERYQPELLLVTRGKAGVLAAFQQKFTHFNARP 240 ANVVKLSEEELVFIS S+DLA GIAS+T RYQPELLLVT+GKAGVLAAFQQ+FTHF+A+P Sbjct: 181 ANVVKLSEEELVFISGSDDLAQGIASITARYQPELLLVTQGKAGVLAAFQQQFTHFSAKP 240 Query: 241 VASVDTTGAGDAFVAGLLASLAANGMPTDMTALEPTLTLAQTCGALATTAKGAMTALPYQ 300 V SVDTTGAGDAFVAGLLASLAA GMPTD+ LEPTLTLAQTCGALATTAKGAMTALPYQ Sbjct: 241 VVSVDTTGAGDAFVAGLLASLAAKGMPTDIEGLEPTLTLAQTCGALATTAKGAMTALPYQ 300 Query: 301 RDLNRQF 307 RDLNRQF Sbjct: 301 RDLNRQF 307 Lambda K H 0.320 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory