Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate BWI76_RS11090 BWI76_RS11090 beta-ketoacyl-ACP reductase
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Koxy:BWI76_RS11090 Length = 244 Score = 152 bits (383), Expect = 8e-42 Identities = 99/242 (40%), Positives = 135/242 (55%), Gaps = 12/242 (4%) Query: 17 DGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFER---LNVTD 73 +G+ ALVTG ++GIG IA L GA+V I + G A + G + LNVTD Sbjct: 4 EGKIALVTGASRGIGRAIAETLVARGAKV-IGTATSESGAQAISDYLGANGKGLLLNVTD 62 Query: 74 ADAV----ADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCREFG 129 ++ ++ +VD+LVNNAGI R+ DD+W ++ NL VF + Sbjct: 63 PASIESVLGNIRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVM 122 Query: 130 RTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVNAVA 189 R M+ + G I++ S+ G + N QA Y A+KA +I ++SLA E ASRG+ VN VA Sbjct: 123 RAMMKKRHGRIITIGSVVGTMGN--AGQANYAAAKAGLIGFSKSLAREVASRGITVNVVA 180 Query: 190 PGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHTLVVD 249 PG+ T +TR T E R L P GRL P EIA AV +LASD AS++TG TL V+ Sbjct: 181 PGFIETDMTRA--LTDEQRAGTLAAVPAGRLGSPNEIASAVAFLASDEASYITGETLHVN 238 Query: 250 GG 251 GG Sbjct: 239 GG 240 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 244 Length adjustment: 24 Effective length of query: 231 Effective length of database: 220 Effective search space: 50820 Effective search space used: 50820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory