Align D-sorbitol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate BWI76_RS19360 BWI76_RS19360 glucose dehydrogenase
Query= reanno::acidovorax_3H11:Ac3H11_2940 (244 letters) >FitnessBrowser__Koxy:BWI76_RS19360 Length = 249 Score = 266 bits (680), Expect = 3e-76 Identities = 131/239 (54%), Positives = 177/239 (74%) Query: 6 NLQGQVAAITGAASGIGFASAQTMADAGARVVLIDRDEAALAKACATIGPNALPLVLDLL 65 +L G+VAAITGAASGIG A+T+ +GA+VVLIDR+ L K A +G NA L +DL+ Sbjct: 11 SLSGKVAAITGAASGIGLECAKTLLGSGAKVVLIDREGEKLNKIVAELGENAFALQVDLM 70 Query: 66 DARQCASLLQRTLALAGQLDIFHANAGLYVGGDLVDADPDAIDRMLNLNVNVVMKNVHNV 125 A Q +LLQ L LAG+LDIFHANAG Y+GG + + DPD DR+L+LN+N + V +V Sbjct: 71 QAEQVDNLLQGILRLAGRLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSV 130 Query: 126 LPHMIERGTGDIIVTSSLAAHFPTPWEPVYASSKWAVNCFVQTVRRQVFKHGIRVGSISP 185 LPH+I + +GDII TSS+A P WEP+Y +SK+AV FV T RRQV ++G+RVG++ P Sbjct: 131 LPHLIAQKSGDIIFTSSIAGVVPVIWEPIYTASKFAVQAFVHTTRRQVSQYGVRVGAVLP 190 Query: 186 GPVITSLLADWPAEKLAEAKASGSLIEAAEVAEVVLFMLTRPRGMTIRDVVMMPTNFDL 244 GPV+T+LL DWP K+ EA A+GSL++ EVAE VLFM+TR + +T+RD+V++P + DL Sbjct: 191 GPVVTALLDDWPKAKMDEALANGSLMQPIEVAESVLFMVTRSKNVTVRDIVILPNSVDL 249 Lambda K H 0.321 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 249 Length adjustment: 24 Effective length of query: 220 Effective length of database: 225 Effective search space: 49500 Effective search space used: 49500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory