Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate 201059 SO1897 isovaleryl-CoA dehydrogenase (NCBI ptt file)
Query= metacyc::G1G01-166-MONOMER (393 letters) >FitnessBrowser__MR1:201059 Length = 389 Score = 221 bits (562), Expect = 4e-62 Identities = 134/371 (36%), Positives = 199/371 (53%), Gaps = 5/371 (1%) Query: 19 LTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGL 78 L E+ M+RD+ + FAQ ++AP + I+ +G +GLLG T+PE+YGG+ + Sbjct: 12 LGEDVDMLRDAVHDFAQHEIAPIAAKVDHDNAFPNEIWPVLGGMGLLGVTVPEEYGGANM 71 Query: 79 NYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFG 138 Y+ + + E+ R + S+L + IN G AQK KYLPKL SGE IG Sbjct: 72 GYLAHVVAMEEISRASASIGLSYGAHSNLCVNQINRNGNAAQKAKYLPKLVSGEHIGALA 131 Query: 139 LTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDD----AGDIRGF 194 ++EPN GSD SM ARK Y L G+KMWITN P A+ +V++AK D A I F Sbjct: 132 MSEPNAGSDVVSMKLHARKEGDRYILNGNKMWITNGPDANTYVIYAKTDLTKGAHGITAF 191 Query: 195 VLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDV-RGLKGPFTCLNSARY 253 ++E+G++G S K+G+R S T E+V ++V VPEENI + G+K + L+ R Sbjct: 192 IVERGFKGFSQAQKLDKLGMRGSNTCELVFEDVEVPEENILGGLNNGVKVLMSGLDYERV 251 Query: 254 GISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGR 313 +S G LG AC Y +R+QFG+ + QL+Q KLADM T + A + + Sbjct: 252 VLSGGPLGIMNACMDIVVPYIHEREQFGKSIGEFQLVQGKLADMYTGMNAAKAYVYSVAK 311 Query: 314 MKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEG 373 D G + + S A +A A +LGGNG +E+ R L + ++ G Sbjct: 312 SCDRGETTRKDAAGAILYSAELATKMALDAIQLLGGNGYVNEYATGRLLRDAKLYEIGAG 371 Query: 374 THDVHALILGR 384 T ++ +++GR Sbjct: 372 TSEIRRMLIGR 382 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 389 Length adjustment: 31 Effective length of query: 362 Effective length of database: 358 Effective search space: 129596 Effective search space used: 129596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory