Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate 200453 SO1275 succinate-semialdehyde dehydrogenase (NCBI ptt file)
Query= BRENDA::P25553 (479 letters) >FitnessBrowser__MR1:200453 Length = 482 Score = 337 bits (865), Expect = 4e-97 Identities = 179/467 (38%), Positives = 279/467 (59%), Gaps = 3/467 (0%) Query: 10 YIDGQFVTWRGDAWIDVVNPATEAVISRIPD-GQAEDARKAIDAAERAQPEWEALPAIER 68 YI+GQ+ + + NPAT AVI+ +P GQAE + AI AAE A P W AL A ER Sbjct: 14 YINGQWCDANSKETVAITNPATGAVIACVPVMGQAE-TQAAIAAAEAALPAWRALTAKER 72 Query: 69 ASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQ 128 + LR+ + E + +++ L+ E GK A+ EV + A +I++ AE A+R G+ I Sbjct: 73 GAKLRRWFELLNENSDDLALLMTSEQGKPLTEAKGEVTYAASFIEWFAEEAKRIYGDTIP 132 Query: 129 SDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAF 188 + + I++ K+ +GVT I PWNFP +I RK APAL G T+V+KP+ TP A+A Sbjct: 133 GHQGDKRIMVIKQPVGVTAAITPWNFPAAMITRKAAPALAAGCTMVVKPAPQTPFTALAL 192 Query: 189 AKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKV 248 A + + G+P GVF+++ G +G E+ NP V +S TGS + G K+MA A + K+ Sbjct: 193 AVLAERAGIPAGVFSVITGDAIAIGNEMCTNPIVRKLSFTGSTNVGIKLMAQCAPTLKKL 252 Query: 249 CLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEA 308 LELGG AP IV DDA+++ AV+ + ++ N+GQ C CA R+YVQ G+YD+F +L A Sbjct: 253 SLELGGNAPFIVFDDANIDAAVEGAMIAKYRNAGQTCVCANRIYVQAGVYDEFAEKLSMA 312 Query: 309 MQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVAFGGKAVEGKGYYYPPT 368 + ++ G + GPLINAAA+E+V+ + A+++GA V GGK E G ++ PT Sbjct: 313 VAKLKVGEGIIAG-VTTGPLINAAAVEKVQSHLEDAIKKGATVLAGGKVHELGGNFFEPT 371 Query: 369 LLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIK 428 +L + + M + EETFGP+ P+ F+ ++D I AND+++GL + Y +++++ K + Sbjct: 372 VLTNADKSMRVAREETFGPLAPLFKFNDVDDVIKQANDTEFGLAAYFYGRDISLVWKVAE 431 Query: 429 GLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVV 475 L++G +N G + SG+G K+G+ EYL+ + + Sbjct: 432 SLEYGMVGVNTGLISTEVAPFGGMKSSGLGREGSKYGIEEYLEIKYI 478 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 482 Length adjustment: 34 Effective length of query: 445 Effective length of database: 448 Effective search space: 199360 Effective search space used: 199360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory