Align N-succinylglutamate 5-semialdehyde dehydrogenase; Succinylglutamic semialdehyde dehydrogenase; SGSD; EC 1.2.1.71 (characterized)
to candidate 202599 SO3496 aldehyde dehydrogenase (NCBI ptt file)
Query= SwissProt::O50174 (487 letters) >FitnessBrowser__MR1:202599 Length = 498 Score = 189 bits (480), Expect = 2e-52 Identities = 147/470 (31%), Positives = 229/470 (48%), Gaps = 20/470 (4%) Query: 5 YIAGQWL-AGQGETLESLDPVGQGVVWSGRGADATQVDAAVCAAREAFPA--WARRPLEQ 61 +I G++ A G T + + P+ ++ D + AV ARE F + W++ + Sbjct: 24 FINGEYRDASSGNTFDCISPIDGRLLAPVASCDLMDANIAVANAREVFDSGVWSKAAPVK 83 Query: 62 RIELLERFAATLKSRADELARVIGEETGKPL-WESATEVTSMVNKVAISVQAFRERTGEK 120 R +++ RFA L+ A+ELA + + GKP+ + A +V + S +A + E Sbjct: 84 RKQVMIRFAELLEENANELALLETLDMGKPIRFSKAVDVAGAARAIRWSGEAIDKLYDEL 143 Query: 121 SGPLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCVVFKPSELTPKVAEL 180 + + ++ +P GVVA P+NFP + + PAL+ GN V+ KPSE +P A Sbjct: 144 APTAHNEIGMITREPVGVVAAIVPWNFPLLMACWKLGPALVTGNSVILKPSEKSPLTAIR 203 Query: 181 TLKAWIQAGLPAGVLNLVQG-GRETGVALAAHRGLDGLFFTGSSRTGNLLHSQFGGQPQK 239 + +QAG+P GVLN++ G G G ALA H +D L FTGS++ L G K Sbjct: 204 IAELAVQAGIPKGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMIYAGESNMK 263 Query: 240 ILALEMGGNNP-LVVEEVADLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWGDALLAR 298 + LE GG +P +V + DL AA ++ + G+ CT RLLV G D L+ Sbjct: 264 RVWLEAGGKSPNIVFNDAPDLKAAAVAAAEAIGFNQGEVCTAGSRLLVESGV-KDELVGL 322 Query: 299 LVAVSATLRVGRFDEQPAPFMGAVISLSAAEHLL---KAQEH---LIGKGAQPLLAMTQP 352 + A+ + G +P GAV+ + +L KA ++ + G Q +LA T Sbjct: 323 IAEELASWQPGH-PLEPTTVSGAVVDKQQLDTILSYIKAGQNEGASLVYGGQQVLAET-- 379 Query: 353 IDGAALLTPGIL-DVSAVAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGLAAGLLSD 411 G + P + +V + EE FGP+L VI ++ AI AN T YGLAAG+ + Sbjct: 380 --GGVYVQPTVFSNVKNQMKIASEEIFGPVLSVIEFNGMEEAIAIANDTIYGLAAGVWTA 437 Query: 412 SRERFEQFLVESRAGIVNWNKQLTGAASSAPFGGIGASGNHRPSAYYAAD 461 + + R+G+V W G +APFGG SGN R + ++ D Sbjct: 438 DISKAHKTAKALRSGMV-WINHYDGGDMTAPFGGYKQSGNGRDKSLHSFD 486 Lambda K H 0.318 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 597 Number of extensions: 32 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 498 Length adjustment: 34 Effective length of query: 453 Effective length of database: 464 Effective search space: 210192 Effective search space used: 210192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory