Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate 201943 SO2813 oxidoreductase, short chain dehydrogenase/reductase family (NCBI ptt file)
Query= SwissProt::Q92RN6 (256 letters) >FitnessBrowser__MR1:201943 Length = 254 Score = 119 bits (299), Expect = 5e-32 Identities = 90/260 (34%), Positives = 136/260 (52%), Gaps = 18/260 (6%) Query: 1 MTLPSSQFPDLRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAES-SLALCEKVAA 59 +T+ SS +L+ + V GG GIGAA+V+ A +GA VAF +++E+ S L ++V A Sbjct: 4 LTMKSSN--NLQGKVAFVQGGSRGIGAAIVKRLASEGAAVAFTYVSSEAQSQLLVDEVIA 61 Query: 60 QTGQAPHFIQADLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESL 119 Q G+A I+AD EA+R A E A LG + ++VNNA ++E +T E W+ + Sbjct: 62 QGGKA-IAIKADSTEPEAIRRAIRETKAHLGGLDIVVNNAGILIWDSIENLTLEDWERIV 120 Query: 120 SVNLRHLFFMCQAVAPHMQRQGGGSIVNFSSIAFLLNMPEIP-----AYSTAKAGIIGLT 174 + N+R +F Q A HM GG I+N S N IP Y +K+ ++GL Sbjct: 121 NTNVRSVFVASQEAALHM--NDGGRIINIGS----TNAERIPFVGGAIYGMSKSALVGLA 174 Query: 175 KSLAGKLGPDNIRVNAILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCL 234 K LA LGP I VN I PG + T+ + E I + L R A+++ Sbjct: 175 KGLARDLGPRAITVNNIQPGPVDTDMNPDNGDSSEPIKAI---GVLGRYGKAEEIASFVA 231 Query: 235 FLASDSSAAMTAQAMIIDGG 254 F+A + +T +++IDGG Sbjct: 232 FIAGPEAGYITGASLMIDGG 251 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 254 Length adjustment: 24 Effective length of query: 232 Effective length of database: 230 Effective search space: 53360 Effective search space used: 53360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory