Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate 199928 SO0742 iron(III) ABC transporter, ATP-binding protein (NCBI ptt file)
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__MR1:199928 Length = 349 Score = 150 bits (380), Expect = 3e-41 Identities = 91/250 (36%), Positives = 143/250 (57%), Gaps = 22/250 (8%) Query: 16 LEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILLD 75 L + +H Y ++LKG+DLT+ +G ++ L+G SG GKTTLLR V L+ G+I Sbjct: 5 LNLHQVHSDYQGQQILKGLDLTLAQGEILALLGPSGCGKTTLLRAVAGLQAISQGEI--- 61 Query: 76 GESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKV----KK 131 ++NGK V + + + + GM FQ + LFPHLT +N+ G+ K+ +K Sbjct: 62 -------QINGKTVSGAGQFVPSEQRGIGMIFQDYALFPHLTVAENILFGVAKLTTAQRK 114 Query: 132 LHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSAL 191 D+ + L + LE GL +R YP +LSGGQQQRV+IARA+A P L+L DE S + Sbjct: 115 ARLDDMLALVK--LE--GLAKR---YPHELSGGQQQRVSIARALAYEPQLLLLDEPFSNI 167 Query: 192 DPELVGEVLSVIKG-LAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFER 250 D ++ +++ I+ L + ++ + VTH AF +D + +QG I + G ++L+ Sbjct: 168 DAQVRHSMMAEIRSILKQRNVSAVFVTHSKDEAFVFADTLAIFSQGVIVQHGRAEDLYAA 227 Query: 251 PQSPRLAEFL 260 P S +A+FL Sbjct: 228 PNSRYVADFL 237 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 349 Length adjustment: 27 Effective length of query: 238 Effective length of database: 322 Effective search space: 76636 Effective search space used: 76636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory