Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate 199928 SO0742 iron(III) ABC transporter, ATP-binding protein (NCBI ptt file)
Query= reanno::Phaeo:GFF2754 (331 letters) >FitnessBrowser__MR1:199928 Length = 349 Score = 190 bits (483), Expect = 4e-53 Identities = 102/253 (40%), Positives = 157/253 (62%), Gaps = 8/253 (3%) Query: 2 TALQLTNVCKSFGPVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEIS 61 + L L V + ++LK ++LT+ GE + +GPSGCGK+TLLR ++GL+ + GEI Sbjct: 3 STLNLHQVHSDYQGQQILKGLDLTLAQGEILALLGPSGCGKTTLLRAVAGLQAISQGEIQ 62 Query: 62 IGGQTVTTT----PPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEA 117 I G+TV+ P +RGI M+FQ YAL+PHL+V EN+ + + + + AR+ + Sbjct: 63 INGKTVSGAGQFVPSEQRGIGMIFQDYALFPHLTVAENILFGVAKLTTAQRK--ARLDDM 120 Query: 118 SRMLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIA 177 ++ LE R P ELSGGQ+QRV+I RA+ EP+L L DEP SN+DA +R + EI Sbjct: 121 LALVKLEGLAKRYPHELSGGQQQRVSIARALAYEPQLLLLDEPFSNIDAQVRHSMMAEIR 180 Query: 178 RLHRQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIGAP 237 + +Q + S ++VTH + EA AD + + G I Q G +LY P +R+VA+F+G+ Sbjct: 181 SILKQRNVSAVFVTHSKDEAFVFADTLAIFSQGVIVQHGRAEDLYAAPNSRYVADFLGSG 240 Query: 238 AMNFVPAQRLGGN 250 N++PA+ + G+ Sbjct: 241 --NYLPAEVVDGH 251 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 349 Length adjustment: 28 Effective length of query: 303 Effective length of database: 321 Effective search space: 97263 Effective search space used: 97263 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory