Align ABC transporter related (characterized, see rationale)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 151 bits (381), Expect = 2e-41 Identities = 86/240 (35%), Positives = 142/240 (59%), Gaps = 19/240 (7%) Query: 7 VALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVS 66 +++ ++ ++K FG+ + ++L+ G++ ++LG SGSGK+T LR + LE D G V Sbjct: 1 MSIHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVK 60 Query: 67 LAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPM---RV 123 GE++ + + +G VFQ++ L+ HMTV EN+ G R Sbjct: 61 FNGEDITTQHVSE---------------RGVGFVFQHYALFKHMTVFENVAYGLTVRPRK 105 Query: 124 QKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTS 183 + S+AE E+ +LL V L YP+ LSGGQ+QR+A+ARALA+ PKV+L DEP Sbjct: 106 TRPSKAEIAEKVHSLLKLVQLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFG 165 Query: 184 ALDPELVGEVLRVMRSLAEE-GRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVF 242 ALD ++ E+ R +R L +E T + VTH+ A V+++++ +++G++E GTP+EV+ Sbjct: 166 ALDAKVRAELRRWLRRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVY 225 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 354 Length adjustment: 27 Effective length of query: 236 Effective length of database: 327 Effective search space: 77172 Effective search space used: 77172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory