Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= uniprot:A0A159ZWL6 (233 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 117 bits (294), Expect = 2e-31 Identities = 72/230 (31%), Positives = 125/230 (54%), Gaps = 11/230 (4%) Query: 2 LQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRYM 61 + + V+ +G A+ SVN+E++ GE+ L+G +G+GK+TLL + G QA SG +++ Sbjct: 3 IHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVKFN 62 Query: 62 GEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMG------GFFTDKGDYQEQMDK 115 GE++ Q H+ + + V + +F +TV EN+A G K + E++ Sbjct: 63 GEDITTQ---HVSERGVGFVFQHYALFKHMTVFENVAYGLTVRPRKTRPSKAEIAEKVHS 119 Query: 116 VLHLFPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDI 175 +L L +L + +SGG++Q +A+ RAL +PK+LLLDEP L + ++ Sbjct: 120 LLKLV-QLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRAELRRW 178 Query: 176 IEQLRKD-GVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDP 224 + +L + VT V + +AL++AD+ V+ GR+ QGT E + P Sbjct: 179 LRRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGRIEQQGTPEEVYDTP 228 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 354 Length adjustment: 26 Effective length of query: 207 Effective length of database: 328 Effective search space: 67896 Effective search space used: 67896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory