Align Inositol transport system ATP-binding protein (characterized)
to candidate 203725 SO4655 sulfate ABC transporter, ATP-binding protein (NCBI ptt file)
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__MR1:203725 Length = 354 Score = 107 bits (266), Expect = 4e-28 Identities = 69/220 (31%), Positives = 117/220 (53%), Gaps = 10/220 (4%) Query: 8 IRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFE 67 I +Q + KHFG+ +A+ V++++ GE LLG +G+GK+T ++ ++G+ + G + F Sbjct: 3 IHIQQVNKHFGNFVAVDSVNLEIKTGELTALLGPSGSGKTTLLRIIAGLEQADSGIVKFN 62 Query: 68 GQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMG-NEPIRKIGPLKLFDHDYANR 126 G+ + + G+ V QH A+ M+V N G RK P K + A + Sbjct: 63 GEDI---TTQHVSERGVGFVFQHYALFKHMTVFENVAYGLTVRPRKTRPSKA---EIAEK 116 Query: 127 ITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTAN 186 + + K+ D+ LSGG+RQ +A+ARA+ KVL+LDEP AL + A Sbjct: 117 V--HSLLKLVQLDWTADRYPSQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRAE 174 Query: 187 VLATIDKVRKQ-GVAVVFITHNVRHALAVGDRFTVLNRGK 225 + + ++ + V VF+TH+ AL V D+ V+N+G+ Sbjct: 175 LRRWLRRLHDEINVTTVFVTHDQEEALEVADKIVVMNKGR 214 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 354 Length adjustment: 27 Effective length of query: 234 Effective length of database: 327 Effective search space: 76518 Effective search space used: 76518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory