Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate 200225 SO1042 amino acid ABC transporter, ATP-binding protein (NCBI ptt file)
Query= CharProtDB::CH_001555 (400 letters) >FitnessBrowser__MR1:200225 Length = 241 Score = 154 bits (389), Expect = 3e-42 Identities = 90/219 (41%), Positives = 134/219 (61%), Gaps = 4/219 (1%) Query: 51 IEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAM 110 I +GE+ ++G SGSGKST +R +N L PT+G + I+G I DA + ++R+K + M Sbjct: 24 IRQGEVVSVIGPSGSGKSTFLRCINLLENPTQGDIEIEGQSITA-KDACVDKLRQK-VGM 81 Query: 111 VFQSFALMPHMTVLDN-TAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGM 169 VFQ+F L PH TVL N T + L + E KAL L QVGL++ A++YP LSGG Sbjct: 82 VFQNFNLFPHKTVLQNITLAPVSLKLMTQAEADNKALALLTQVGLQDKANAYPSSLSGGQ 141 Query: 170 RQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAM 229 +QRV +ARALA+ PD++L DE SALDP + ++ D ++K A+ T+V ++H++ A Sbjct: 142 KQRVAIARALAMEPDLMLFDEPTSALDPEMVGDVLD-VMKDLAQKGMTMVIVTHEMGFAR 200 Query: 230 RIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGV 268 + DR+ M G VV+ P+E+ P ++F V Sbjct: 201 DVSDRVIFMDGGYVVESNIPEELFTRPKEARTQSFLSKV 239 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 241 Length adjustment: 27 Effective length of query: 373 Effective length of database: 214 Effective search space: 79822 Effective search space used: 79822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory